KEGG   Bacillus subtilis subsp. subtilis 168: BSU25540
Entry
BSU25540          CDS       T00010                                 

Symbol
gpr
Name
(RefSeq) germination protease
  KO
K06012  spore protease [EC:3.4.24.78]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU25540 (gpr)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.78  gpr endopeptidase
     BSU25540 (gpr)
Peptidases and inhibitors [BR:bsu01002]
 Aspartic peptidases
  Family A25: gpr protease family
   BSU25540 (gpr)
SSDB
Motif
Pfam: Peptidase_A25 DUF1256 Csm4_C
Other DBs
NCBI-GeneID: 937838
NCBI-ProteinID: NP_390432
Pasteur: BG10438
BSORF: BG10438
UniProt: P22322 A0A6M3ZHC5
Position
complement(2634505..2635611)
AA seq 368 aa
MKKSELDVNQYLIRTDLAVETKEAMANQQAVPTKEIKGFIEKERDHGGIKIRTVDVTKEG
AELSGKKEGRYLTLEAQGIRENDSEMQEKVSAVFAEEFSAFLENLNISKDASCLIVGLGN
WNVTPDALGPMAVENLLVTRHLFKLQPENVQEGYRPVSAFAPGVMGITGIETSDIIKGVI
EQSKPDFVIAIDALAARAVERVNTTIQISDTGIHPGSGVGNKRKDLSKDTLGVPVIAIGV
PTVVDAVTIASDTVDYILKHFGREMKDNRPSRSLVPAGMTFGKKKVLTEDDLPDQKQRQS
FLGIVGTLQEDEKRQLIHEVLSPLGHNLMVTPKEVDSFIDDMANVLANGLNTALHEKVSQ
ENKGSYNH
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaaaaagagtgagctggatgtgaatcagtatttgatacggaccgatttggcagtggaa
acgaaggaagcaatggccaatcagcaggctgtgccgacaaaagaaattaaaggctttatt
gaaaaagagcgtgatcacggcggcattaaaatccgcacagttgatgttacaaaggaaggc
gcagagctttcgggaaaaaaagaagggcgctatttaacgcttgaagcacagggaatcagg
gagaatgattcggaaatgcaggagaaggtctctgctgtctttgcggaggaattctcagct
tttcttgaaaaccttaatatctcaaaagatgcgagctgtttgatcgttgggctcggcaac
tggaacgtgacacctgatgcgcttggaccgatggcagtagaaaatctgttggtaacaagg
cacttgtttaagcttcagccggaaaacgtacaggagggttacaggcctgtcagtgctttt
gcaccgggtgtaatggggataacaggaatcgaaacaagtgacattattaaaggtgtgatt
gagcaatcgaagcctgattttgtcatcgccattgatgcgttggcggcgcgggcggtggaa
agggtcaacacaaccattcaaatatcggatacaggcattcacccggggtctggagtgggg
aataaacgaaaagatttaagcaaagacacgcttggtgttccggtgattgctatcggtgtt
ccgacagtagttgatgccgtgacaattgccagcgacacggtggactacatattaaaacat
tttggcagagaaatgaaggataacaggccatcaagatcgcttgttccggcaggcatgacg
tttgggaaaaagaaagtgctcactgaagacgatcttcccgatcaaaagcagcgccaatcg
ttcctaggtattgtcggaacccttcaagaagatgaaaaacggcagctcattcacgaggtg
ctttcgcctttagggcacaacttaatggttacaccgaaggaagtcgattcatttatcgac
gatatggcaaatgttttagcgaacggattaaacacagcgcttcatgaaaaagtgtcacaa
gaaaacaaaggctcctacaatcactaa

DBGET integrated database retrieval system