KEGG   Bacillus subtilis subsp. subtilis 168: BSU25550Help
Entry
BSU25550          CDS       T00010                                 

Gene name
rpsT
Definition
(RefSeq) 30S ribosomal protein S20
  KO
K02968  small subunit ribosomal protein S20
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU25550 (rpsT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU25550 (rpsT)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    BSU25550 (rpsT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p DUF2250
Motif
Other DBs
NCBI-GeneID: 937837
NCBI-ProteinID: NP_390433
Pasteur: BG11643
BSORF: BG11643
UniProt: P21477
Position
2635815..2636081
Genome map
AA seq 88 aa AA seqDB search
MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDK
AVKTGLVHKNTAARYKSRLAKKVNGLSA
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacattaaatcagcgattaaacgtacaaaaacaaacaacgaacgccgcgttcat
aacgcgacaatcaaatctgctatgcgtactgcaatcaaacaagttgaagcttctgttgcc
aacaacgaagctgacaaagcgaaaactgctcttactgaagcagctaaacgtattgataaa
gcagtgaaaacaggtcttgtacacaaaaataccgcagctcgatacaaatcaagactagcg
aaaaaagtgaacggactttctgcataa

DBGET integrated database retrieval system