KEGG   Bacillus subtilis subsp. subtilis 168: BSU25569
Entry
BSU25569          CDS       T00010                                 

Symbol
yqzM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqzM
Other DBs
NCBI-GeneID: 8303117
NCBI-ProteinID: YP_003097762
UniProt: C0H453 A0A6M4JL59
Position
2637369..2637503
AA seq 44 aa
MNDFEKNVQSKRNDAVDSAVGFVVSFGFFAFLFVMATVIHLVGS
NT seq 135 nt   +upstreamnt  +downstreamnt
ttgaatgattttgaaaaaaacgttcaaagcaaacgaaatgatgctgtagattcagctgtt
ggttttgttgtgtccttcggatttttcgccttcttgtttgtcatggcaacggttattcac
ctagttggttcataa

DBGET integrated database retrieval system