KEGG   Bacillus subtilis subsp. subtilis 168: BSU25570
Entry
BSU25570          CDS       T00010                                 

Symbol
comEC
Name
(RefSeq) ComE operon protein 3
  KO
K02238  competence protein ComEC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU25570 (comEC)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU25570 (comEC)
SSDB
Motif
Pfam: Competence Lactamase_B DUF4131 Lactamase_B_2 Peptidase_M50B SpoU_sub_bind
Other DBs
NCBI-GeneID: 937839
NCBI-ProteinID: NP_390435
Pasteur: BG10482
BSORF: BG10482
UniProt: P39695 A0A6M3ZEB6
Position
complement(2637543..2639873)
AA seq 776 aa
MRNSRLLLPMAAASATAGITAAAYFPAIFLFILFLLIILIKTRHAFLIIVCFFSFILFFV
LYAVTDSQNVSSYRQGTYQFKAVIDTIPKIDGDRMSMMVETPDKEKWAAAYRIQSAGEKE
QLLYIEPGMSCELTGTLEEPNHATVPGAFDYNEYLYRQHIHWNYSVTSIQNCSEPENFKY
KVLSLRKHIISFTNSLLPPDSTGIVQALTVGDRFYVEDEVLTAYQKLGVVHLLAISGLHV
GILTAGLFYIMIRLGITREKASILLLLFLPLYVMLTGAAPSVLRAALMSGVYLAGSLVKW
RVRSATAICLSYIVLLLFNPYHLFEAGFQLSFAVSFSLILSSSIFQQVKTSLGQLTIVSL
IAQLGSLPILLYHFHQFSIISVPMNMLMVPFYTFCILPGAVAGVLLLSLSASFGRLFFSW
FDLLISWINRLITNIADVDVFTIMIAHPAPVLLFLFTVTIILLLMAIEKRSLSQLMVTGG
ICCTVMFLLFIYPCLSSEGEVDMIDIGQGDSMFVGAPHQRGRVLIDTGGTLSYSSEPWRE
KQHPFSLGEKVLIPFLTAKGIKQLDALILTHADQDHIGEAEILLKHHKVKRLVIPKGFVS
EPKDEKVLQAAREEGVAIEEVKRGDVLQIKDLQFHVLSPEAPDPASKNNSSLVLWMETGG
MSWILTGDLEKEGEQEVMNVFPNIKADVLKVGHHGSKGSTGEEFIQQLQPKTAIISAGKN
NRYHHPHQKVLQLLQRHSIRVLRTDQNGTIQYRYKNRVGTFSVYPPYDTSDITETN
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgcgtaattcgcgcttattattgcctatggcggcagcttcggcaacggctggaattact
gccgccgcttatttccccgctatttttcttttcatcctctttctcctcatcattttaatc
aaaacgaggcacgcttttcttattattgtttgtttcttctcttttatattgttttttgta
ctgtatgcagtcacagattctcagaatgtctcttcctatcggcagggaacctatcaattc
aaggcagtgattgacactattcccaaaattgacggcgaccgtatgtctatgatggttgag
acacctgataaggaaaaatgggctgctgcgtatcgcattcagtctgctggtgaaaaagaa
cagctgttatacatagaaccaggaatgtcatgtgagttgactggtacattggaagaaccg
aatcacgcaactgtgccgggtgcatttgattataacgagtatctttatcggcagcatatt
cattggaactactctgtcacgtctatccaaaactgcagcgaacctgaaaatttcaagtac
aaggtgctcagcttgagaaaacatatcatatcattcacaaacagccttctgcctcctgat
tcgacagggattgtacaggcacttacagttggtgacagattttacgtggaggatgaagtg
cttaccgcgtatcaaaagcttggtgttgtccatctcttggcaatatcaggactccacgtg
gggattttgacagcaggtttgttttatatcatgatccgccttggtataactagagaaaag
gcgtcaattctgttgctgttatttctgccgctctatgtgatgttgaccggcgctgctcct
tcagtgctacgcgccgctctcatgtcgggtgtttacttagctggaagtcttgtcaaatgg
cgtgtccgctctgcaactgcaatttgcctttcgtacatcgtccttctgctcttcaatcct
tatcatctctttgaagccggttttcagctatcgttcgccgtcagtttttctttaattcta
tcctcttctatttttcagcaggttaaaacctccttggggcagctgacaattgtatcactc
atcgctcagctgggctcgcttccgattctcctatatcattttcatcagttttctatcatc
agcgtaccgatgaatatgttgatggtaccattttataccttctgtattttgccgggagct
gtagcaggtgttcttctattaagtctttccgcttcgtttgggagattgtttttcagctgg
tttgatttattgataagctggatcaataggttaatcacaaacattgcagatgttgatgtg
ttcacgattatgatcgcacatcctgcacctgttttgctttttttattcacagtcacgatc
atcctattgcttatggcgattgaaaaacgctccttgtcgcagttgatggtaaccggaggc
atttgctgcacggtgatgtttctgctctttatatatccgtgtcttagttccgaaggagaa
gtggatatgatagatattggacagggtgacagcatgtttgtaggtgctccgcatcagcgg
ggtcgtgtcttaattgataccggcggcactttgtcttactcgtcagagccttggcgcgaa
aaacagcatccgttttcactgggggaaaaggtgctgattccgtttttaactgctaaggga
atcaagcagcttgacgctttaattctgacgcacgctgaccaagatcatatcggagaggcg
gagattctgctgaagcatcataaagtaaagcgcctcgtgattccgaaagggttcgtttct
gaacctaaagatgagaaagtgctgcaggcagccagggaagagggagtggcaattgaagag
gtgaagcgaggcgatgtgttgcaaataaaggatttgcagttccatgtactgtcaccggaa
gcacctgatccggcaagcaaaaataattcatctctcgttctgtggatggagacgggcggt
atgagctggatcttgacgggtgatctggagaaagaaggggaacaagaggtgatgaacgtg
tttccgaatataaaagcagatgtgttaaaggtggggcaccatgggagcaaaggctctacc
ggtgaagaattcatccaacagcttcagccgaaaacggccattatctcagccgggaaaaac
aatcggtaccatcatcctcatcaaaaagttctgcaactattacagagacattctatccgc
gtgctgcgaacagatcaaaacggaacgatccaatatagatacaaaaacagagttggaacc
ttttctgtctatcctccatatgatacatcagatataacagagacgaactaa

DBGET integrated database retrieval system