KEGG   Bacillus subtilis subsp. subtilis 168: BSU25580
Entry
BSU25580          CDS       T00010                                 

Symbol
comEB
Name
(RefSeq) ComE operon protein 2
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU25580 (comEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU25580 (comEB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     BSU25580 (comEB)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU25580 (comEB)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam XOO_2897-deam SNAD4 IMS APOBEC_N
Other DBs
NCBI-GeneID: 937832
NCBI-ProteinID: NP_390436
Pasteur: BG10481
BSORF: BG10481
UniProt: P32393 A0A6M4JLK7
Position
complement(2639877..2640446)
AA seq 189 aa
MERISWNQYFMAQSHLLALRSTCPRLSVGATIVRDKRMIAGGYNGSIAGGVHCADEGCLM
IDDHCARTIHAEMNAILQCSKFGVPTDGAEIYVTHYPCIQCCKSIIQAGIKTVYYAEDYK
THPYAQELFEQAGVTVEQVELDEMIVDLKNREKLSFVAGLIGKLADAGLAEEELKKIHEQ
ANTLFTSYV
NT seq 570 nt   +upstreamnt  +downstreamnt
gtggaacgaatttcatggaatcaatactttatggctcaaagccatttattggcgctgcgc
agcacatgtccgagattatctgtcggcgctactatagtcagagacaaacgcatgatagca
ggaggctacaatgggtcaatcgcgggcggcgtacattgtgcagatgaaggatgcttaatg
atagatgatcattgcgcaagaaccattcacgctgaaatgaatgcgattcttcaatgctct
aagtttggggtgccgactgatggagccgagatttatgtgacgcattatccgtgcattcaa
tgctgcaaatctattattcaagctggtatcaaaacggtttattatgctgaggattacaaa
acacatccgtatgcgcaggaattatttgaacaggcgggtgtaactgttgaacaggttgaa
ctcgatgaaatgatcgttgatctgaaaaacagagaaaagctttcatttgtagcgggtcta
atagggaaattggctgatgccggtttagcggaggaagaattgaaaaagatacatgaacag
gcgaatacacttttcacgagctacgtgtga

DBGET integrated database retrieval system