KEGG   Bacillus subtilis subsp. subtilis 168: BSU25590
Entry
BSU25590          CDS       T00010                                 

Symbol
comEA
Name
(RefSeq) ComE operon protein 1
  KO
K02237  competence protein ComEA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU25590 (comEA)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU25590 (comEA)
SSDB
Motif
Pfam: HHH_3 HHH SLBB HHH_5 HHH_2 HHH_6 T2SSK PsbU DNA_pol_lambd_f
Other DBs
NCBI-GeneID: 937827
NCBI-ProteinID: NP_390437
Pasteur: BG10480
BSORF: BG10480
UniProt: P39694 A0A6M3ZDX2
Position
complement(2640513..2641130)
AA seq 205 aa
MNWLNQHKKAIILAASAAVFTAIMIFLATGKNKEPVKQAVPTETENTVVKQEANNDESNE
TIVIDIKGAVQHPGVYEMRTGDRVSQAIEKAGGTSEQADEAQVNLAEILQDGTVVYIPKK
GEETAVQQGGGGSVQSDGGKGALVNINTATLEELQGISGVGPSKAEAIIAYREENGRFQT
IEDITKVSGIGEKSFEKIKSSITVK
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaattggttgaatcagcataagaaagcaattattttagcggcttctgcggctgttttc
acagcgattatgatctttctggccacagggaaaaataaagagccggtgaagcaagctgta
ccaacagagacagaaaatacagtggtaaagcaggaagcaaacaacgacgagtcaaacgaa
acaattgtgatagacatcaaaggtgctgttcagcatcctggcgtttatgaaatgcgaaca
ggggacagagtatctcaggcaattgagaaagcgggcgggaccagtgaacaagcagacgaa
gcgcaagtaaatttggcggagattctgcaggacgggacagtggtgtacatcccgaaaaag
ggagaggaaacagcagtgcagcaaggtggcggagggtctgtccaaagcgatggagggaag
ggagcgctggtgaatatcaatacagcaaccttagaggagttacaaggcatctcaggggtg
gggccatccaaagctgaagctattattgcataccgggaggaaaacggtcgtttccaaaca
attgaagatatcactaaggtttcaggaataggtgaaaagtcatttgagaaaataaagtct
tccattacagtaaagtga

DBGET integrated database retrieval system