KEGG   Bacillus subtilis subsp. subtilis 168: BSU25600Help
Entry
BSU25600          CDS       T00010                                 

Gene name
comER
Definition
(RefSeq) ComE operon protein 4
  KO
K02239  competence protein ComER
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00429  Competence-related DNA transformation transporter
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU25600 (comER)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components [MD:M00429]
   BSU25600 (comER)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored P5CR_dimer NAD_binding_2 Shikimate_DH GFO_IDH_MocA ApbA Lgl_C SBDS_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 937834
NCBI-ProteinID: NP_390438
Pasteur: BG10479
BSORF: BG10479
UniProt: P39696
Position
2641214..2642035
Genome map
AA seq 273 aa AA seqDB search
MKIGFIGTGNMGTILIESFIESKAADPSNMTITNRTIEKALHIKNRYNSINVTESLEKLV
SENEMIFICVKPLDIYPLLARALPYLRKDHILISITSPVQTEQLEQYVPCQVARVIPSIT
NRALAGVSLVTFGTSCGESAKAKINELMQHISHPLQIESDITRVASDIVSCGPAFMSYLI
QRFIDAAVSETSVSKQDAILMCKEMLVGMGKLLETELYTLPALQEKVCVKGGVTGEGIKA
LESGVQDMFHRVFQNTHMKYEEDISAVKKQFHV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgaagataggctttatcggcacaggaaatatgggtacgatccttatcgaatcatttatt
gaatcaaaagcggccgatccctcaaacatgacaatcacaaaccgcacaattgaaaaagcg
ttgcacataaaaaaccgctacaacagcataaacgttaccgaaagtctcgaaaagctcgtt
tctgaaaacgagatgatttttatttgtgttaagccgcttgatatatatcctttactggca
agagcgttaccttatttaagaaaagatcatattctcatttcaattacaagccccgttcaa
accgaacagctcgaacaatatgtgccgtgtcaagtggcgcgagtgatcccaagtattacg
aacagagcgctggcaggtgtttctctcgtcactttcggcacaagctgcggcgaatctgca
aaagcgaaaatcaatgagctgatgcagcatatctctcatccgctgcaaattgaaagtgac
atcacgagggttgcatcagacatcgtaagctgcggccccgcttttatgagctatctgatt
cagcggtttatagatgcagctgtttcggaaacatcagtgtctaaacaggacgcgattttg
atgtgtaaggaaatgcttgtcggaatgggaaaactgttagaaaccgaattgtataccctg
cctgcattacaggaaaaggtttgcgttaaaggcggtgtaacaggagaaggcattaaagcg
ctggaaagcggtgtgcaggatatgtttcaccgggtatttcaaaatactcatatgaagtac
gaggaggatatttccgcagtgaaaaagcagtttcatgtgtag

DBGET integrated database retrieval system