KEGG   Bacillus subtilis subsp. subtilis 168: BSU25600
Entry
BSU25600          CDS       T00010                                 

Symbol
comER
Name
(RefSeq) ComE operon protein 4
  KO
K02239  competence protein ComER
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU25600 (comER)
Secretion system [BR:bsu02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   BSU25600 (comER)
SSDB
Motif
Pfam: F420_oxidored P5CR_dimer NAD_binding_2 Shikimate_DH GFO_IDH_MocA ApbA Lgl_C NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 937834
NCBI-ProteinID: NP_390438
Pasteur: BG10479
BSORF: BG10479
UniProt: P39696 A0A6M4JMI1
Position
2641214..2642035
AA seq 273 aa
MKIGFIGTGNMGTILIESFIESKAADPSNMTITNRTIEKALHIKNRYNSINVTESLEKLV
SENEMIFICVKPLDIYPLLARALPYLRKDHILISITSPVQTEQLEQYVPCQVARVIPSIT
NRALAGVSLVTFGTSCGESAKAKINELMQHISHPLQIESDITRVASDIVSCGPAFMSYLI
QRFIDAAVSETSVSKQDAILMCKEMLVGMGKLLETELYTLPALQEKVCVKGGVTGEGIKA
LESGVQDMFHRVFQNTHMKYEEDISAVKKQFHV
NT seq 822 nt   +upstreamnt  +downstreamnt
ttgaagataggctttatcggcacaggaaatatgggtacgatccttatcgaatcatttatt
gaatcaaaagcggccgatccctcaaacatgacaatcacaaaccgcacaattgaaaaagcg
ttgcacataaaaaaccgctacaacagcataaacgttaccgaaagtctcgaaaagctcgtt
tctgaaaacgagatgatttttatttgtgttaagccgcttgatatatatcctttactggca
agagcgttaccttatttaagaaaagatcatattctcatttcaattacaagccccgttcaa
accgaacagctcgaacaatatgtgccgtgtcaagtggcgcgagtgatcccaagtattacg
aacagagcgctggcaggtgtttctctcgtcactttcggcacaagctgcggcgaatctgca
aaagcgaaaatcaatgagctgatgcagcatatctctcatccgctgcaaattgaaagtgac
atcacgagggttgcatcagacatcgtaagctgcggccccgcttttatgagctatctgatt
cagcggtttatagatgcagctgtttcggaaacatcagtgtctaaacaggacgcgattttg
atgtgtaaggaaatgcttgtcggaatgggaaaactgttagaaaccgaattgtataccctg
cctgcattacaggaaaaggtttgcgttaaaggcggtgtaacaggagaaggcattaaagcg
ctggaaagcggtgtgcaggatatgtttcaccgggtatttcaaaatactcatatgaagtac
gaggaggatatttccgcagtgaaaaagcagtttcatgtgtag

DBGET integrated database retrieval system