KEGG   Bacillus subtilis subsp. subtilis 168: BSU25620
Entry
BSU25620          CDS       T00010                                 

Symbol
yqeL
Name
(RefSeq) hypothetical protein
  KO
K09710  ribosome-associated protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25620 (yqeL)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU25620 (yqeL)
SSDB
Motif
Pfam: RsfS
Other DBs
NCBI-GeneID: 937819
NCBI-ProteinID: NP_390440
Pasteur: BG11640
BSORF: BG11640
UniProt: P54457 A0A6M3ZHD5
Position
complement(2642841..2643197)
AA seq 118 aa
MNQKSILKIAAAACDDKRAEDILALDMEGISLVADYFLICHGNSDKQVQAIAREIKDQAD
ENGIQVKKMEGFDEARWVLVDLGDVVVHVFHKDERSYYNLEKLWGDAPLADLDFGMNQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaaccaaaagtccattttaaagatcgcagctgcggcttgcgatgataaacgggcagag
gatattttagcactggatatggaaggtatttctctggttgctgattattttctgatctgc
cacggaaattcagataaacaggtacaggcgattgcccgtgaaatcaaggatcaagctgat
gaaaacggcattcaagtcaaaaagatggaaggctttgatgaagcaagatgggttctcgtt
gatctaggcgatgtagttgtccatgtcttccacaaggatgaaagaagctactacaacctt
gaaaagctgtggggagacgctccgctcgcagatcttgactttggaatgaatcaatga

DBGET integrated database retrieval system