KEGG   Bacillus subtilis subsp. subtilis 168: BSU25630
Entry
BSU25630          CDS       T00010                                 

Symbol
yqeK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HD HD_6
Other DBs
NCBI-GeneID: 937831
NCBI-ProteinID: NP_390441
Pasteur: BG11639
BSORF: BG11639
UniProt: P54456 A0A6M3ZEA2
Position
complement(2643215..2643775)
AA seq 186 aa
MNREEALACVKQQLTEHRYIHTVGVMNTAIELAERFGADSKKAEIAAIFHDYAKFRPKEE
MKQIIAREKMPAHLLDHNPELWHAPVGAYLVQREAGVQDEDILDAIRYHTSGRPGMTLLE
KVIYVADYIEPNRAFPGVDEVRKLAETDLNQALIQSIKNTMVFLMKKNQPVFPDTFLTYN
WLVSGS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaatcgtgaggaggcacttgcatgcgtgaagcagcaattgaccgaacaccgatatatc
catacggttggcgtgatgaacacggcgatcgaacttgcggagcgttttggagccgattct
aaaaaagcggaaatagcggcaatctttcatgattacgccaaattccgcccgaaagaagaa
atgaaacaaattattgcgcgtgaaaaaatgcctgcgcatttattggatcataatccggag
ctctggcacgctccggtcggcgcttatttggtccaaagagaggcaggggttcaagatgaa
gacattcttgacgccattaggtatcatacctcaggccgccccggcatgacacttttagaa
aaagtcatttacgttgccgattacattgagccaaaccgggcatttcccggtgtcgatgag
gtgcgtaagcttgctgagacagatttgaatcaagcgctgattcagtccattaaaaataca
atggtttttcttatgaaaaaaaatcaaccggtttttccagacacatttttaacgtataac
tggcttgtgtctggcagctga

DBGET integrated database retrieval system