KEGG   Bacillus subtilis subsp. subtilis 168: BSU25640
Entry
BSU25640          CDS       T00010                                 

Gene name
nadD
Definition
(RefSeq) nicotinate-nucleotide adenylyltransferase
  KO
K00969  nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00115  NAD biosynthesis, aspartate => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU25640 (nadD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     BSU25640 (nadD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-GeneID: 937818
NCBI-ProteinID: NP_390442
Pasteur: BG11638
BSORF: BG11638
UniProt: P54455 A0A6M4JJC0
Structure
PDB: 
1KAM 1KAQ

Position
complement(2643765..2644334)
AA seq 189 aa
MKKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHKQNEDYTDSFHRVEML
KLAIQSNPSFKLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLD
ELLNLIQFIGVKRPGFHVETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKY
VEENGLYES
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaagaaaatcggaattttcggaggcacgtttgaccctccgcataatggtcacctctta
atggcgaatgaggtgctgtaccaggcggggcttgatgaaatttggtttatgcctaatcaa
attccgccgcataaacagaacgaagactataccgacagctttcatcgcgtggaaatgcta
aagcttgcaattcaatctaatccgtcctttaagctggagcttgttgaaatggaaagagaa
gggccatcatatacctttgataccgtttctttactgaagcagcgttatccaaatgatcag
ctgttctttattatcggcgctgatatgattgaatatttgccgaaatggtataagctggac
gagctgctgaacctcattcaatttattggagtaaagcgccccggttttcatgttgaaacc
ccttatccgcttctctttgcagacgttccggaatttgaggtatcatcaactatgataagg
gaacggtttaaaagcaagaagcccactgactacttaatccctgataaagtgaagaagtat
gtagaggagaatggtttatatgaatcgtga

DBGET integrated database retrieval system