KEGG   Bacillus subtilis subsp. subtilis 168: BSU25650
Entry
BSU25650          CDS       T00010                                 

Gene name
yqeI
Definition
(RefSeq) RNA-binding protein YqeI
  KO
K07574  RNA-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25650 (yqeI)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  Other maturation factors
   BSU25650 (yqeI)
SSDB
Motif
Pfam: CRS1_YhbY
Other DBs
NCBI-GeneID: 937813
NCBI-ProteinID: NP_390443
Pasteur: BG11637
BSORF: BG11637
UniProt: P54454 A0A6M4JJF4
Position
complement(2644346..2644636)
AA seq 96 aa
MLTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEARELIKVSVLQNCEEDKND
VAEALVKGSRSQLVQTIGNTIVLYKESKENKQIELP
NT seq 291 nt   +upstreamnt  +downstreamnt
atgttaacaggtaaacaaaaacgttttttgcgttcaaaagcgcatcatttaacgccgatt
tttcaagtaggtaaaggcggagtaaacgacaacatgattaaacaaattgctgaggcgctt
gaagcgagagagctgattaaagtcagcgtgcttcagaattgcgaagaggataaaaacgat
gtagcggaagctcttgtaaaaggaagccgctctcaattggtgcagacaatcggcaatacg
attgtgttatataaggaatcaaaggaaaataaacaaatcgagcttccttaa

DBGET integrated database retrieval system