KEGG   Bacillus subtilis subsp. subtilis 168: BSU25660
Entry
BSU25660          CDS       T00010                                 
Symbol
aroE
Name
(RefSeq) shikimate dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu00999  Biosynthesis of various plant secondary metabolites
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU25660 (aroE)
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various plant secondary metabolites
    BSU25660 (aroE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase (NADP+)
     BSU25660 (aroE)
SSDB
Motif
Pfam: Shikimate_dh_N SDH_C Shikimate_DH Sacchrp_dh_NADP F420_oxidored OCD_Mu_crystall Stanniocalcin
Other DBs
NCBI-GeneID: 937820
NCBI-ProteinID: NP_390444
Pasteur: BG11522
BSORF: BG11522
UniProt: P54374 A0A6M4JL68
Position
complement(2644630..2645472)
AA seq 280 aa
MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLEDAVKGIRALGVQGIN
VTVPHKVSIMDYLDHIDESAKVLGAVNTVRREGDKLVGYNTDGEGFVKSLMKVLDKPISE
LSFLMIGAGGAARAIFTTIVRNTPKKFDICNRTLEKAKRLTEATPSFHNKEVLSIKEAEE
RLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYNPIQTALLKEASQKGLKTL
DGVGMFVEQAALSFQLWTGQEPNIEKMRSIVIGKLGGTEC
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaaaaagctgtacggggttatcggaaatcctattggccattctatgtcacctgatatt
cataacgcatcattgaaagacctcgggcttgacggacattatcatgccttcaaggtagaa
gagaatgatctggaggatgcggtaaaaggaataagagctctaggcgtacaaggaatcaat
gtgactgttccgcacaaggtttccattatggattatttggatcatattgatgagagtgca
aaagtgctcggtgccgtaaacacggtcagaagagagggagataagcttgtcggatacaat
accgatggggaaggcttcgtgaagtcattaatgaaggtattagacaagcccatctctgaa
ctgtcattcttaatgatcggcgctggcggagcggcgagagccatttttacaacaattgtc
cgaaataccccgaaaaaatttgacatttgcaaccggacgttagaaaaagcaaagcggctt
acagaagctactccctcgtttcacaataaagaagtattaagcataaaagaagcagaagaa
cgtcttgagcagtatgatgttatcatccatacaacgtctgtgggcatgtatccgaacgtg
gacgatgtgccgctttcattacagcgtgccgcgagcagtgccgtcgtatgtgatatcgtg
tataatccaatacagacggcacttttaaaagaagcaagccaaaaaggcttgaaaacactc
gatggtgtgggcatgtttgttgaacaggcagcattgtctttccaattgtggactggacaa
gagcctaatattgaaaaaatgagatctattgtaataggaaaattaggaggaacagaatgt
taa

DBGET integrated database retrieval system