KEGG   Bacillus subtilis subsp. subtilis 168: BSU25660Help
Entry
BSU25660          CDS       T00010                                 

Gene name
aroE
Definition
(RefSeq) shikimate dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Module
bsu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSU25660 (aroE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     BSU25660 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N SDH_C Shikimate_DH Sacchrp_dh_NADP F420_oxidored OCD_Mu_crystall Stanniocalcin
Motif
Other DBs
NCBI-GeneID: 937820
NCBI-ProteinID: NP_390444
Pasteur: BG11522
BSORF: BG11522
UniProt: P54374
Position
complement(2644630..2645472)
Genome map
AA seq 280 aa AA seqDB search
MKKLYGVIGNPIGHSMSPDIHNASLKDLGLDGHYHAFKVEENDLEDAVKGIRALGVQGIN
VTVPHKVSIMDYLDHIDESAKVLGAVNTVRREGDKLVGYNTDGEGFVKSLMKVLDKPISE
LSFLMIGAGGAARAIFTTIVRNTPKKFDICNRTLEKAKRLTEATPSFHNKEVLSIKEAEE
RLEQYDVIIHTTSVGMYPNVDDVPLSLQRAASSAVVCDIVYNPIQTALLKEASQKGLKTL
DGVGMFVEQAALSFQLWTGQEPNIEKMRSIVIGKLGGTEC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgtacggggttatcggaaatcctattggccattctatgtcacctgatatt
cataacgcatcattgaaagacctcgggcttgacggacattatcatgccttcaaggtagaa
gagaatgatctggaggatgcggtaaaaggaataagagctctaggcgtacaaggaatcaat
gtgactgttccgcacaaggtttccattatggattatttggatcatattgatgagagtgca
aaagtgctcggtgccgtaaacacggtcagaagagagggagataagcttgtcggatacaat
accgatggggaaggcttcgtgaagtcattaatgaaggtattagacaagcccatctctgaa
ctgtcattcttaatgatcggcgctggcggagcggcgagagccatttttacaacaattgtc
cgaaataccccgaaaaaatttgacatttgcaaccggacgttagaaaaagcaaagcggctt
acagaagctactccctcgtttcacaataaagaagtattaagcataaaagaagcagaagaa
cgtcttgagcagtatgatgttatcatccatacaacgtctgtgggcatgtatccgaacgtg
gacgatgtgccgctttcattacagcgtgccgcgagcagtgccgtcgtatgtgatatcgtg
tataatccaatacagacggcacttttaaaagaagcaagccaaaaaggcttgaaaacactc
gatggtgtgggcatgtttgttgaacaggcagcattgtctttccaattgtggactggacaa
gagcctaatattgaaaaaatgagatctattgtaataggaaaattaggaggaacagaatgt
taa

DBGET integrated database retrieval system