KEGG   Bacillus subtilis subsp. subtilis 168: BSU25680
Entry
BSU25680          CDS       T00010                                 

Symbol
yqeG
Name
(RefSeq) hypothetical protein
  KO
K07015  putative phosphatase [EC:3.1.3.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25680 (yqeG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     BSU25680 (yqeG)
SSDB
Motif
Pfam: HAD_2 Hydrolase_like PGP_phosphatase Hydrolase Hydrolase_3 Hydrolase_6 HAD AhpC-TSA DUF5805 Glyco_trans_4_2 S6PP
Other DBs
NCBI-GeneID: 937815
NCBI-ProteinID: NP_390446
Pasteur: BG11635
BSORF: BG11635
UniProt: P54452 A0A6M4JLL4
Position
complement(2646594..2647112)
AA seq 172 aa
MLKKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRPNATPRLIEWFEEMKE
HGIKVTIVSNNNERRVKLFSEPLGIPFIYKARKPMGKAFNRAVRNMELKKEDCVVIGDQL
LTDVLGGNRNGYHTILVVPVASSDGFITRFNRQVERRILSALKRKGHIQWEE
NT seq 519 nt   +upstreamnt  +downstreamnt
ttgttaaaaaagttttttttacctgacgagtttgtaaaaaatatttttcatattacacct
gagaaattaaaggaacgaaatgtaaaaggaattattactgacctggataatacgcttgtt
gaatgggacaggccgaacgcgacgccgcgattgatcgagtggtttgaagaaatgaaggaa
cacggcattaaagtgacaattgtctctaataataacgaaagaagagtgaaacttttctca
gaaccgcttggaatcccattcatctataaagcaagaaaaccgatgggtaaagcctttaat
agagcggtgcgcaatatggagctgaaaaaagaggactgcgttgtcatcggagaccagctg
ctgaccgatgtactcgggggaaaccgaaacggctaccatacgattttggtcgtgccagtc
gcttcctctgacggattcattacgcgctttaaccgccaggtcgaacgcagaatactgagt
gctctcaaacgaaaagggcacattcagtgggaggagtaa

DBGET integrated database retrieval system