KEGG   Bacillus subtilis subsp. subtilis 168: BSU25690
Entry
BSU25690          CDS       T00010                                 

Symbol
sda
Name
(RefSeq) sporulation inhibitor sda
  KO
K06371  developmental checkpoint coupling sporulation initiation to replication initiation
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU25690 (sda)
SSDB
Motif
Pfam: Sda
Other DBs
NCBI-GeneID: 2914223
NCBI-ProteinID: YP_054588
Pasteur: BG14183
BSORF: BG14183
UniProt: Q7WY62
Structure
Position
2647456..2647614
AA seq 52 aa
MNWVPSMRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS
NT seq 159 nt   +upstreamnt  +downstreamnt
attaattgggttcctagcatgagaaaactgtctgatgaattactaatagaatcttatttc
aaagccaccgaaatgaatttaaaccgtgactttattgagttaattgaaaacgaaataaaa
agaagatcgctcggacatattatttccgtatcttcttaa

DBGET integrated database retrieval system