KEGG   Bacillus subtilis subsp. subtilis 168: BSU25700
Entry
BSU25700          CDS       T00010                                 

Symbol
yqeF
Name
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-GeneID: 937814
NCBI-ProteinID: NP_390447
Pasteur: BG11634
BSORF: BG11634
UniProt: P54451 A0A6M3ZDX9
Position
complement(2647920..2648651)
AA seq 243 aa
MKHFIILFLLLFVTAGCEGRGYEDVVAFGDSNTRGSNWDYRDYPKAQQWVNILKTAERGN
LDILNAGIGGQTTEDARLRFQTDVLDQKPKYLFIMFGTNDAAILTEGKPRVSKQRFRENL
VYFIEESRKHGIKPILMTCIPIIEGNGKHHLFYYSRYQAAAFEPKGGARKWHNSYNDITR
DVSKRLDVPLVDNWKHFIEADGGKATDEALIQSGLIDPSGNHMTPKGARIVYEGIQDGQI
LQR
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaacattttatcatccttttccttctgctgttcgttacagcaggatgcgagggaagg
ggatacgaagacgttgtagcatttggtgacagtaatacgcgtggctctaattgggattat
cgcgattatccaaaagcacagcagtgggtcaatatattaaaaacagctgagcgcggtaac
cttgatatactcaatgcgggaatcggcggacagacgacagaggatgcccgtctccgattt
cagacagatgtgctggatcaaaaaccgaagtatttgtttattatgttcggaaccaatgac
gctgccatactgactgaggggaaaccgagagtgtcgaagcagcgttttagagaaaatctg
gtttattttattgaagaaagcagaaaacacgggatcaagccaatcttaatgacgtgtatc
ccaattatagaaggtaatgggaagcatcatttgttttactattccagatatcaagcagct
gcttttgaaccaaaaggcggagcaaggaaatggcacaactcatataacgatattacaaga
gatgtgtcgaagcgcctggatgtccctcttgtagataactggaagcattttatagaagca
gacggcggaaaagcaactgatgaagcgcttatccaatctggtcttatagatccttctgga
aatcatatgacacctaaaggggcaaggatcgtatatgaaggaatacaagatgggcagatc
ctgcagcgttga

DBGET integrated database retrieval system