KEGG   Bacillus subtilis subsp. subtilis 168: BSU25710
Entry
BSU25710          CDS       T00010                                 

Symbol
cwlH
Name
(RefSeq) N-acetylmuramoyl-L-alanine amidase CwlH
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25710 (cwlH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU25710 (cwlH)
SSDB
Motif
Pfam: Amidase_2 PG_binding_1
Other DBs
NCBI-GeneID: 937808
NCBI-ProteinID: NP_390448
Pasteur: BG11633
BSORF: BG11633
UniProt: P54450 A0A6M3ZE50
Position
complement(2648903..2649655)
AA seq 250 aa
MVTIKKDFIPVSNDNRPGYAMAPAYITVHNTANTAKGADAKMHAKFVKNPNTSESWHFTV
DDSVIYQHLPIDENGWHAGDGTNGTGNRKSIGIEICENADGDFEKATSNAQWLIRKLMKE
NNIPLNRVVPHKKWSGKECPRKLLDHWNSFLNGISSSDTPPKETSPSYPLPSGVIKLTSP
YRKGTNILQLQKALAVLHFYPDKGAKNNGIDGVYGPKTANAVKRFQLMNGLTADGIYGPK
TKAKLKSKLK
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtaaccataaaaaaggattttataccggtatcaaatgataatcgtcctggctatgcg
atggcgcctgcttatattacggtgcataatacagcgaatacagccaaaggcgctgatgcg
aaaatgcacgccaagtttgtgaaaaacccgaacacatccgaaagctggcattttacagtt
gacgattcagtcatttatcagcatctcccgatagatgaaaacggctggcatgcgggagac
ggtacaaacgggacaggaaaccgcaaatcgatcgggattgaaatctgtgaaaatgctgac
ggcgattttgaaaaagcaacatcaaatgcccagtggctgatcagaaagctgatgaaggaa
aacaatattccgttaaatcgtgttgttccccacaaaaagtggtccgggaaagaatgtccg
cggaaactcttggaccactggaactcttttctaaacggaatttcttcctcggatacacct
ccaaaagaaacttcaccatcatatcctctgccgtctggggttataaagctcacttcgcct
tatcgaaagggcacaaacattctccagctgcaaaaggctttagctgtacttcacttttac
cctgataagggagccaaaaacaatggcatagatggagtttacggaccgaaaacagcgaat
gccgtcaagcgttttcaactcatgaacggattaactgcagacgggatttatgggccaaaa
acaaaggccaagcttaaatcgaagttaaagtaa

DBGET integrated database retrieval system