KEGG   Bacillus subtilis subsp. subtilis 168: BSU25720
Entry
BSU25720          CDS       T00010                                 

Symbol
yqeD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNARE_assoc PsbJ
Other DBs
NCBI-GeneID: 937812
NCBI-ProteinID: NP_390449
Pasteur: BG11632
BSORF: BG11632
UniProt: P54449 A0A6M4JNQ8
Position
2649842..2650468
AA seq 208 aa
MLKKVIGILVIIAIISVGFFQKEAWLDAIKAGGMFSVLFSMLLIAADVFFPIVPFALIAA
LNGAVFGTANGIWITLTGSMLGTILLFFLARYSFRDWARKKVQAYPAIQSYEASFNKNAF
TAVLLGRLIPVIPSLVMNVICGLSQVRWHVFFFASLIGKIPNIVVVTIAGANFTSNKLLS
ISIYGTYILIIMLVIYKKFPHLLKVPKK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttaaaaaaagtaataggtatacttgtgattatcgctatcatttcagttggttttttt
cagaaagaagcttggcttgatgcaatcaaagcaggagggatgttttccgttttatttagt
atgctgctgattgctgccgatgtttttttcccaatagtgccgtttgctttgattgctgct
ttaaatggcgcagtgttcgggactgcaaatggaatttggattacactgaccggctcaatg
cttggtacaatattgctgttttttctcgccaggtacagttttagagattgggccagaaaa
aaagttcaggcctatcctgccatacaaagctacgaggcttccttcaacaaaaacgctttt
accgctgttttattaggaaggctgatacctgtcataccttcacttgtaatgaacgtgatc
tgcgggctgagccaggttcgctggcatgtttttttctttgcgtctttaatagggaaaatc
cccaatattgttgttgtcactattgcaggtgccaatttcaccagcaataaattattgtct
atcagcatttacggtacatatattctgatcatcatgctggtcatttataaaaagttccct
catcttctgaaggtgccaaaaaaataa

DBGET integrated database retrieval system