KEGG   Bacillus subtilis subsp. subtilis 168: BSU25730
Entry
BSU25730          CDS       T00010                                 

Symbol
yqeC
Name
(RefSeq) 6-phosphogluconate dehydrogenase YqeC
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU25730 (yqeC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU25730 (yqeC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BSU25730 (yqeC)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BSU25730 (yqeC)
SSDB
Motif
Pfam: NAD_binding_2 6PGD UDPG_MGDP_dh_N 3HCDH_N F420_oxidored NAD_binding_11 TrkA_N 2-Hacid_dh_C NAD_Gly3P_dh_N PDH_N
Other DBs
NCBI-GeneID: 937809
NCBI-ProteinID: NP_390450
Pasteur: BG11631
BSORF: BG11631
UniProt: P54448 A0A6M3ZEA8
Position
complement(2650487..2651380)
AA seq 297 aa
MKIGLIGLGKMGINIGKQFIDRNHQVVGYDVNQAAVDELKAYGAEGTTNLKEFISLLHPP
RILWVMVPHGIVDAVLRDVSPLLSKGDMIIEAGNSHYKESIRRYNQMKEAGIHYLDAGTS
GGMEGARHGACFMVGGDHEAWEIVEPLFRDTAVENGYLYAGEAGSGHFLKMIHNGIEYGM
MAAIGEGFEVLENSQFDFDYEKVARVWNHGSVIRSWLMGLTERAFAKDAKLDQIKGIMHS
SGEGKWTVETALDLQTATPVIAMSLMMRYRSLTDDTFTGKVVAALRNEFGGHATEKK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaaaatcggattaatcggcttagggaaaatgggcataaacataggaaagcaattcatt
gaccgcaatcatcaagtggttggatatgatgtaaatcaagcggctgttgatgaactgaaa
gcatacggggctgaggggacaacaaatcttaaagagttcatttctttattacacccgccg
cgcatcctatgggttatggtaccgcatggcattgtcgatgctgttttgcgtgatgtatca
cctttattaagtaaaggcgatatgattatcgaagctggaaactctcattataaagaatca
attcgccgctacaatcaaatgaaagaagcgggtatccattatctcgatgccggaacgtcg
ggcggaatggaaggcgcacggcatggagcctgttttatggtggggggcgatcatgaagca
tgggagattgtggaaccgctttttcgtgatactgccgtcgaaaatggttatctatacgct
ggtgaagcgggaagcggacattttttaaaaatgatccataatggaattgagtatggaatg
atggccgcgattggtgaaggattcgaagtgcttgaaaacagccaatttgattttgactac
gagaaggttgccagagtgtggaatcatggttctgtcattcgttcttggcttatgggactg
actgagcgagctttcgctaaggatgcgaaactggatcagatcaagggcattatgcattcc
tcaggtgaaggaaaatggacggtggaaaccgcgcttgatctgcagacggcaacgccggtc
atcgccatgtcactaatgatgagataccgttctttaacagacgatacgtttacaggaaag
gtggttgctgcgcttcgaaatgaatttggaggccatgcgacagaaaaaaagtaa

DBGET integrated database retrieval system