KEGG   Bacillus subtilis subsp. subtilis 168: BSU25740
Entry
BSU25740          CDS       T00010                                 

Symbol
yqeB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937802
NCBI-ProteinID: NP_390451
Pasteur: BG11630
BSORF: BG11630
UniProt: P54447 A0A6M4JJD4
Position
2651632..2652354
AA seq 240 aa
MLQNQSHTLIGVTKTAVFFLYAALAIIGFAIGYFIPQIAKWALSLPWIPLEGPLRLITSF
QGSTASFITALLGMCAGIWFAHSVIAMLLSVKITDHTVEFIKGKKVQTIHSDDIALVFMD
HKRLVLLGTAGYELVREEIDEKPVNVEKAFRQHHYEWATDGDPFKDQFRRWIPDAPDLSQ
GAHALLKARHKALQDEEKDDIEEFRLELAQLGIVVRDEGTRQYWRKAETYPPKIQLGEGL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgttgcagaatcaatctcatactcttattggagttacgaaaaccgctgtattcttttta
tacgctgcacttgcaatcatcggttttgcaatcgggtattttattccgcagattgcgaaa
tgggcattatccctcccctggatccctcttgaaggaccacttcggctcattacctctttt
cagggatctacagcttcatttatcactgctcttctcggtatgtgtgcggggatttggttc
gctcattctgttattgcaatgctgctgtctgtcaaaattacagatcacacagtggaattc
atcaaaggaaaaaaagtgcaaacaattcattccgatgacatcgctcttgtatttatggat
cacaaacggcttgtcctcctgggaacagccggatatgaattggtacgggaagaaattgat
gaaaaaccagtaaacgttgagaaggcctttagacagcatcattacgaatgggcaacagat
ggtgatccgtttaaagatcaatttcgccgatggattcctgatgcaccagacctatcgcaa
ggcgcccatgccttattaaaagctcgtcacaaagcactgcaggacgaagaaaaagacgat
attgaagaattccgtctcgaactggcacagctgggcatcgttgtacgggacgaaggcaca
cgccaatattggcgaaaagcagaaacctatcccccgaaaattcagctcggcgaaggattg
taa

DBGET integrated database retrieval system