KEGG   Bacillus subtilis subsp. subtilis 168: BSU25750
Entry
BSU25750          CDS       T00010                                 

Symbol
nucB
Name
(RefSeq) sporulation-specific extracellular nuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DNase_NucA_NucB
Other DBs
NCBI-GeneID: 937804
NCBI-ProteinID: NP_390452
Pasteur: BG11237
BSORF: BG11237
UniProt: P42983 A0A6M3ZEN7
Position
complement(2652387..2652797)
AA seq 136 aa
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDIC
TIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGN
QMSSYPDGTRVLFIVQ
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaaaaaatggatggcaggcctgtttcttgctgcagcagttcttctttgtttaatggtt
ccgcaacagatccaaggcgcatcttcgtatgacaaagtgttatattttccgctgtctcgt
tatccggaaaccggcagtcatattagggatgcgattgcagagggacatccagatatttgt
accattgacagagatggagcagacaaaaggcgggaggaatctttaaagggaatcccgacc
aagccgggctatgaccgggatgagtggccgatggcggtctgcgaggaaggcggtgcaggg
gctgatgtccgatatgtgacgccttctgataatcgcggcgccggctcgtgggtagggaat
caaatgagcagctatcctgacggtaccagagtgctgtttattgtgcagtag

DBGET integrated database retrieval system