KEGG   Bacillus subtilis subsp. subtilis 168: BSU25770
Entry
BSU25770          CDS       T00010                                 

Symbol
spoIVCA
Name
(RefSeq) DNA recombinase
  KO
K06400  site-specific DNA recombinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU25770 (spoIVCA)
SSDB
Motif
Pfam: Resolvase Recombinase Zn_ribbon_recom Snapin_Pallidin FapA LPP SOAR
Other DBs
NCBI-GeneID: 937799
NCBI-ProteinID: NP_390454
Pasteur: BG10458
BSORF: BG10458
UniProt: P17867 A0A6M3ZE18
Position
complement(2653371..2654873)
AA seq 500 aa
MIAIYVRVSTEEQAIKGSSIDSQIEACIKKAGTKDVLKYADEGFSGELLERPALNRLRED
ASKGLISQVICYDPDRLSRKLMNQLIIDDELRKRNIPLIFVNGEYANSPEGQLFFAMRGA
ISEFEKAKIKERTSSGRLQKMKKGMIIKDSKLYGYKFVKEKRTLEILEEEAKIIRMIFNY
FTDHKSPFFGRVNGIALHLTQMGVKTKKGAKVWHRQVVRQILMNSSYKGEHRQYKYDTEG
SYVSKQAGNKSIIKIRPEEEQITVTIPAIVPAEQWDYAQELLGQSKRKHLSISPHNYLLS
GLVRCGKCGNTMTGKKRKSHGKDYYVYTCRKNYSGAKDRGCGKEMSENKLNRHVWGEIFK
FITNPQKYVSFKEAEQSNHLSDELELIEKEIEKTKKGRKRLLTLISLSDDDDLDIDEIKA
QIIELQKKQNQLTEKCNEIQSKMKVLDDTSSSENALKRAIDYFQSIGADNLTLEDKKTIV
NFIVKEVTIVDSDTIYIETY
NT seq 1503 nt   +upstreamnt  +downstreamnt
gtgatagcaatatatgtaagggtatcgaccgaggaacaagcgatcaagggatcgagcatc
gacagccaaatcgaggcctgtataaagaaagcagggactaaagatgtgctgaagtatgca
gatgaaggattttcaggagagcttttagaacgtccggctttgaatcgcttgagggaggat
gcaagcaagggacttataagtcaagtcatttgttacgatcctgaccgtctttctcggaaa
ttaatgaatcagctaatcattgatgacgaattgcgaaagcgaaacatacctttgattttt
gtaaatggtgaatacgccaattctccagaaggtcaattgtttttcgcaatgcgcggggca
atctcagaatttgaaaaagccaaaatcaaagaacggacatcaagcggccgacttcaaaaa
atgaaaaaaggcatgatcattaaagattctaaactatatggctataaatttgttaaagag
aaaagaactcttgagatattagaagaggaagcaaaaatcattcggatgatttttaactat
ttcaccgatcataaaagcccttttttcggcagagtaaatggtattgctctacatttaact
cagatgggggttaaaacaaaaaaaggcgccaaagtatggcacaggcaggttgttcggcaa
atattaatgaactcttcctataagggtgaacatagacagtataaatatgatacagagggt
tcctatgtttcaaagcaggcagggaacaaatctataattaaaataaggcctgaagaagaa
caaatcactgtgacaattccagcaattgttccagctgaacaatgggattatgctcaagaa
ctcttaggtcaaagtaaaagaaaacacttgagtatcagccctcacaattacttgttatcg
ggtttggttagatgcggaaaatgcggaaataccatgacagggaagaaaagaaaatcacat
ggtaaagactactatgtatatacttgccggaaaaattattctggcgcaaaggaccgcggc
tgcggaaaagaaatgtctgagaataaattgaaccggcatgtatggggtgaaatttttaaa
ttcatcacaaatcctcaaaagtatgtttcttttaaagaggctgaacaatcaaatcacctg
tctgatgaattagaacttattgaaaaagagatagagaaaacaaaaaaaggccgcaagcgt
cttttaacgctaatcagcctaagcgatgacgatgatttagacatagatgaaatcaaagca
caaattattgaactgcaaaaaaagcaaaatcagcttactgaaaagtgtaacgaaatccag
tcaaaaatgaaagtcctagatgatacgagctcaagtgaaaatgctctaaaaagagccatc
gactattttcaatcaatcggtgcagataacttaactcttgaagataaaaaaacaattgtt
aactttatcgtgaaagaagttaccattgtggattctgacaccatatatattgaaacgtat
taa

DBGET integrated database retrieval system