KEGG   Bacillus subtilis subsp. subtilis 168: BSU25780
Entry
BSU25780          CDS       T00010                                 

Symbol
arsC
Name
(RefSeq) arsenate reductase ArsC
  KO
K03741  arsenate reductase (thioredoxin) [EC:1.20.4.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU25780 (arsC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.4  arsenate reductase (thioredoxin)
     BSU25780 (arsC)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-GeneID: 937801
NCBI-ProteinID: NP_390455
Pasteur: BG11304
BSORF: BG11304
UniProt: P45947 A0A6M3ZEC9
Structure
Position
complement(2655322..2655741)
AA seq 139 aa
MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDIS
NQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFF
QRVRDEIGNRLKEFAETGK
NT seq 420 nt   +upstreamnt  +downstreamnt
atggagaataaaatcatttactttttatgtacagggaactcttgccggagccaaatggct
gaaggatgggctaaacaatatttaggtgatgagtggaaagtgtatagcgcggggatagaa
gcacatggattaaatccgaatgctgttaaagcgatgaaggaagttggtatagatatctct
aatcaaacgtcagatataatcgattctgatattctgaacaatgctgatttagttgttacg
ctttgtggagatgctgctgataaatgcccgatgacgcctccacatgtaaaacgtgagcat
tggggttttgatgatccggcaagagcacaagggacagaagaagaaaaatgggcgtttttc
caaagagttcgtgatgaaatagggaataggttgaaggaatttgctgaaacagggaaataa

DBGET integrated database retrieval system