KEGG   Bacillus subtilis subsp. subtilis 168: BSU25790Help
Entry
BSU25790          CDS       T00010                                 

Gene name
arsB
Definition
(RefSeq) arsenite resistance protein ArsB
  KO
K03325  arsenite transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU25790 (arsB)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU25790 (arsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBF
Motif
Other DBs
NCBI-GeneID: 937800
NCBI-ProteinID: NP_390456
Pasteur: BG11303
BSORF: BG11303
UniProt: P45946
Position
complement(2655753..2656793)
Genome map
AA seq 346 aa AA seqDB search
MKRLSFLDRYLTIWIFLAMALGIGLGFIFPSFVGGLNKLQVGTTSIPLAIGLVLMMYPPL
AKVRYEEIGRVFKDIKVLILSLVQNWIIGPTLMFILAIIFLPDKPEYMIGLIMIGLARCI
AMVIVWNDLSKGDTEYAAGLVAFNSIFQMLFFSVYAYIFVTVIPQWLGMEGAVVNITMAE
VAKSVFIYLGVPFIAGMVTRYIFVKVKGKEWYEKVFIPKISPITLIALLFTIIVMFSLKG
DVIVSLPLDVVRVAIPLLIYFVLMFFVSFFLGKKIGANYAVTTTLAFTAGSNNFELAIAV
AVGVFGIHSGAAFAAVIGPLVEVPVMIALVKVALWFQRKYFGSHSM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttatcttttttagaccgttatttaaccatctggatttttcttgcgatggca
ttggggataggattaggttttatatttccgagttttgttggtggattaaacaaattacaa
gtaggaactacatctatccctttagctattggattagtattaatgatgtatccaccacta
gcaaaggttcgatatgaagaaattggacgggtatttaaagatattaaagtgttaatttta
tctttagtgcaaaactggatcatcggaccgactctcatgtttattttggctatcatcttt
ttgccagataaaccggagtatatgattgggcttattatgattggattagctcgctgtatt
gcgatggttattgtttggaatgacttatcaaaaggtgatacggaatacgcggcaggatta
gttgctttcaactcaattttccaaatgctttttttctcagtttatgcttacatttttgta
acagttattccgcaatggttagggatggaaggagcagtagtgaatattacgatggcagaa
gtcgcaaaatcagtattcatttaccttggagttccttttattgcaggaatggtgacacgt
tatatttttgtaaaagtgaagggcaaagaatggtatgaaaaagtgttcattcctaagatt
agtccaattacgttaattgctttgctatttacaattatcgtcatgttttccttaaaaggt
gatgtaattgttagcttgccgttagatgttgtccgagttgcgattccattattgatttac
tttgttttaatgttctttgtttccttctttttagggaagaaaatcggggcaaactatgct
gtaactactactttagcttttacagcaggaagcaataactttgaattagcgattgctgta
gctgttggtgtatttggaattcattcgggtgcagcatttgccgccgtaattggtccgctt
gtagaagtgccagtcatgatagcacttgttaaggttgctttatggtttcaacgaaaatac
tttggaagtcactcgatgtag

DBGET integrated database retrieval system