KEGG   Bacillus subtilis subsp. subtilis 168: BSU25800
Entry
BSU25800          CDS       T00010                                 

Symbol
yqcK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_6 CBM_21
Other DBs
NCBI-GeneID: 937794
NCBI-ProteinID: NP_390457
Pasteur: BG11302
BSORF: BG11302
UniProt: P45945 A0A6M4JL07
Position
complement(2656816..2657256)
AA seq 146 aa
MKYVHVGVNVVSLEKSINFYEKVFGVKAVKVKTDYAKFLLETPGLNFTLNVADEVKGNQV
NHFGFQVDSLEEVLKHKKRLEKEGFFAREEMDTTCCYAVQDKFWITDPDGNEWEFFYTKS
NSEVQKQDSSSCCVTPPSDITTNSCC
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaatatgttcatgtaggggttaacgttgtcagtttagagaaatcgatcaatttttat
gaaaaagtttttggagtaaaggctgtaaaagtaaaaacagactatgcaaagtttctatta
gagactcctggactgaatttcactttaaatgtcgcagatgaggtgaagggaaatcaagtg
aatcattttggattccaagtagatagtttggaagaagttttgaaacacaagaaaaggctt
gaaaaagaagggttttttgcacgtgaagaaatggatacgacttgttgttatgcagtccaa
gataaattttggattactgatccagatgggaacgagtgggaatttttctataccaaatcg
aacagcgaggttcaaaaacaagattcctcctcttgttgtgtaacaccgccaagtgatatt
acaacgaactcttgctgttag

DBGET integrated database retrieval system