KEGG   Bacillus subtilis subsp. subtilis 168: BSU25810
Entry
BSU25810          CDS       T00010                                 

Symbol
arsR
Name
(RefSeq) arsenical resistance operon repressor
  KO
K03892  ArsR family transcriptional regulator, arsenate/arsenite/antimonite-responsive transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU25810 (arsR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   ArsR family
    BSU25810 (arsR)
SSDB
Motif
Pfam: HTH_5 HTH_20 HTH_34 MarR DUF2513 HTH_24 B-block_TFIIIC DUF4423 MarR_2
Other DBs
NCBI-GeneID: 937789
NCBI-ProteinID: NP_390458
Pasteur: BG11301
BSORF: BG11301
UniProt: P45949 A0A6M4JMJ2
Position
complement(2657317..2657634)
AA seq 105 aa
MDETKSELLRKYEQKFKALADQKRLEIMYELCQRGKTCVCDLTEIFEVTQSKLSYHLKIL
LDANLITKETKGTWSYYDLNDEEVNGLLSEELCCIFRKKGEGDCC
NT seq 318 nt   +upstreamnt  +downstreamnt
atggatgagacgaaatcagaactgctacggaaatatgaacaaaaatttaaggctcttgct
gatcagaaacgattagagatcatgtatgaactttgtcaaaggggaaaaacctgtgtttgt
gatctgactgagatttttgaggtgacgcaatctaaactttcttatcatctaaaaatttta
ttggatgccaacttaataacgaaagagacaaagggaacatggagttattatgatctaaat
gatgaggaagtaaatggtttattatcagaagagctttgttgtatatttagaaaaaaaggt
gaaggagattgctgctaa

DBGET integrated database retrieval system