KEGG   Bacillus subtilis subsp. subtilis 168: BSU25820
Entry
BSU25820          CDS       T00010                                 

Symbol
yqcI
Name
(RefSeq) hypothetical protein
  KO
K09190  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU25820 (yqcI)
SSDB
Motif
Pfam: YqcI_YcgG
Other DBs
NCBI-GeneID: 937795
NCBI-ProteinID: NP_390459
Pasteur: BG11300
BSORF: BG11300
UniProt: P45944 A0A6M3ZE60
Position
complement(2658006..2658770)
AA seq 254 aa
MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGRQAFLSDQLRIAFVGD
PRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDYKIEDYESLFWQLLNSL
SMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRKSRSFPYFMLTFQPRWVF
EDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNLEWKQYFLRDDENQVSQCP
FMKMKNLFKKKRSD
NT seq 765 nt   +upstreamnt  +downstreamnt
ttgactgagttatatgctaaaagtgatcttgaaaaaattaaagaaacgctacctggttgg
caattagattcgtttaactatttgaatgaaaaaataggtgataaagaaaataaatttcct
tgtataccgggaaggcaagcatttttaagcgaccagctgcgaattgcttttgtcggtgat
cctaggaatcccgagactgcgaaggaattagcgccattgcttactcggtatggaactatt
tcacgagagacaggaaagtatgcatcattaactgtaatatttcatacaccagaagaatta
ctgactgattacaaaattgaggattacgaatcgttgttttggcagttgctcaattcattg
agtatggaagatccagctgattggccagatgatataccagaaaatccagataactttcaa
tgggaatactgttttaatggagaaccatattttgttctgtgtgctacaccggctcacagc
aaaagaaaaagcagaagttttccttattttatgttgacgtttcagcctagatgggttttt
gaggatctaaatgatactactgcatttggacgaaatatgagtaagcaaattcgaaaaagg
cttgaggcatatgatgaagtacctatccatccgcatttaggatggtatggaaaaaaagac
aatctggagtggaaacagtacttcttgcgagatgatgaaaatcaagtgtcacaatgccct
tttatgaaaatgaagaacttattcaaaaagaaaaggtctgattaa

DBGET integrated database retrieval system