KEGG   Bacillus subtilis subsp. subtilis 168: BSU25830Help
Entry
BSU25830          CDS       T00010                                 

Gene name
rapE
Definition
(RefSeq) response regulator aspartate phosphatase E
  KO
K06363  response regulator aspartate phosphatase E [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU25830 (rapE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU25830 (rapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapH_N TPR_2 TPR_12 TPR_1 TPR_8 TPR_7 TPR_10 TPR_16 TPR_14 TPR_6 TPR_MalT TPR_19 ANAPC3 DUF4810 RPN7 SNAP TPR_20 DUF4248
Motif
Other DBs
NCBI-GeneID: 937796
NCBI-ProteinID: NP_390460
Pasteur: BG11299
BSORF: BG11299
UniProt: P45943
Position
2659213..2660340
Genome map
AA seq 375 aa AA seqDB search
MISITSAEVGMKINEWHRHIQKFNVTDAEMLKAEIERDIEVMEEDQDLLIYYQLMAFRHK
IMLEYTLPSDENRMELSEYLNKIEGHKKKLDNMRAYYYNFFRGMYEFRNGEYTRAITYYK
KAERKIPTISDKIEKAEFYFKLSEVYYHMKMTHISMHYAELSYNIYKKHELYSVRRIQCH
FVIAGNYDDLENHEKALPHLQEALKGAELLKSKNTHIYATAFFNLGNCYHKMDNLNKAAR
YIEQALVQYRKINSDVLPQAYHDLALIYFKQGKKEQAMDCFRKGIRSAVDFKDELFMNLF
EALDVLYIRNGDTPKLLNIFSRLENGKGYPYLEELALLGGNLFDYNGKIEDSIICFKKMV
YAQKQISKGECMYEI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgatatcaatcacatcagctgaagtgggaatgaagattaatgaatggcataggcatatt
caaaaattcaacgtaactgatgctgaaatgttaaaagctgaaatagaacgtgatatagag
gttatggaagaagatcaagacttgcttatttattatcaactaatggcctttcgccataaa
attatgttggaatacacgctgccatctgatgaaaaccgaatggaactttcagaatattta
aataaaattgagggccataagaaaaaattagacaatatgcgggcatattattataacttc
ttccgcgggatgtatgagtttagaaacggtgaatacacaagagccattacatattacaaa
aaagctgaacgcaaaattcctacaatctccgacaagattgaaaaagctgagttttatttt
aaactgtctgaagtctattatcatatgaaaatgacacacatttcgatgcattacgctgag
ctttcatacaacatttataagaaacacgagctttactctgttcgtcgtattcagtgccat
tttgtcattgccggtaactacgatgaccttgaaaatcatgaaaaagctctcccccacctt
caagaagctttaaaaggtgccgagctgcttaaaagtaaaaatactcatatctatgccact
gcgtttttcaatctcggcaattgctatcacaaaatggacaacttaaataaggctgctcgt
tacatcgaacaagccttggttcaatacagaaaaattaactctgacgtacttccgcaagct
tatcatgacctagcgttgatttattttaaacaaggcaaaaaagaacaagcaatggattgc
ttccgcaaaggaatcagaagtgctgtagattttaaagacgaactatttatgaacttattt
gaagcattagacgttctttatataagaaatggcgatacacctaaacttctcaacattttt
tctcgtttagagaacggcaaaggatacccttatctggaagagctggcattgttaggaggc
aaccttttcgattataatggaaaaatagaggatagtatcatctgtttcaagaagatggta
tatgctcaaaagcaaatatcgaaaggggaatgcatgtatgaaatctaa

DBGET integrated database retrieval system