KEGG   Bacillus subtilis subsp. subtilis 168: BSU25860
Entry
BSU25860          CDS       T00010                                 

Symbol
yqcG
Name
(RefSeq) hypothetical protein
  KO
K21491  toxin YqcG [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU25860 (yqcG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU25860 (yqcG)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YqcG-YqcF
    BSU25860 (yqcG)
SSDB
Motif
Pfam: LXG GH-E PT-TG
Other DBs
NCBI-GeneID: 937792
NCBI-ProteinID: NP_390463
Pasteur: BG11298
BSORF: BG11298
UniProt: P45942 A0A6M4JJK7
Position
2661102..2662697
AA seq 531 aa
MKVFEAKTLLTEAEKRAQEYKDLKSKMVKLKKAFKAVADLDDSEFSGKGANNIKSFYEDQ
AGIADQWIDLIEMKISFLTSIPGFLEDANLSDAYIEETFLAHELANAYTKSKSIMSEQKK
AMKDILNDINDILPLDLFSTETFKNELSSAEKKRKEAIEKMDEVDQNLTSEYGLSEANEQ
MIQADYQALMNATAKGKSASPIHYNAKAYRDSEIHKMTEDVKKQSTDYISFKDQQAEQRR
IAKEQEELANRPWYEKSWDAVCNFTGEVSGYYDYKRAADGVDPVTGEKLTAGQRVAAGAM
AAAGYIPIVGWAGKLAKGGKAVYSTSKALYRADKALDVYKTPKTFHALQNSSKGLYGLAS
ANGFSEAITGRDMFGNKVSKERQEQSLSGAMAMLVPFGARGINKKLNAKSSSRVSEASTN
TSKKPKVPKTYKRPTYFRKGVRDKVWENAKDSTGSVKDPLTKQVMKKDEPWDMGHKPGYE
FRKHQQSAMERNISRKQFLDEHNNPDHYQPELPSSNRSHKGEDMTDDYFGD
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgaaagtatttgaagccaaaaccttgctcaccgaggctgaaaagcgagcacaggaatac
aaagatttaaaaagtaaaatggtcaaattaaagaaagcgttcaaagctgttgcagattta
gatgatagcgagttttcaggcaaaggcgctaataacattaaatcattttatgaagatcaa
gctggcattgctgaccaatggattgatttaattgagatgaaaatttctttcttaacgagt
attcctggttttttagaagatgccaacttatcagatgcctacatagaagaaaccttttta
gcgcatgagcttgctaacgcctacaccaaatcaaaatccattatgtctgaacagaaaaaa
gccatgaaagatatattaaatgatatcaacgatatactgcctttggatctgttctcgaca
gaaacttttaaaaatgaactttcgtctgccgaaaagaaacgaaaagaagccattgagaaa
atggatgaagttgaccaaaacttaacatcagaatacggactatcagaagcaaatgaacaa
atgattcaagctgattatcaagctttaatgaatgcgacagcaaaaggcaaaagcgcctct
cctattcactataatgcgaaggcttatagagacagtgagattcacaagatgactgaggat
gtaaagaaacaatcaacagactacatctcttttaaggaccaacaggcggaacaaagaaga
attgcaaaagaacaagaagaactggcgaacagaccatggtatgaaaagtcttgggatgct
gtttgtaattttacaggagaggtctctggatattatgattataaaagagccgctgatggg
gttgatcctgttaccggcgaaaagctaactgctggacaacgggtcgctgccggtgcaatg
gctgcggcaggatacatccctatcgtaggatgggcaggtaaattagctaaaggtggaaaa
gctgtttattcaacaagtaaagcattgtatagagcagacaaagctctcgatgtatataaa
acacctaagacattccatgcccttcaaaactccagcaaaggactttatggacttgcttct
gcaaatggttttagtgaagctataacaggacgcgatatgttcgggaataaagtctccaaa
gagaggcaagaacagagccttagtggtgcaatggcaatgttggttcctttcggagctcgc
ggaattaacaaaaagcttaatgcaaaatcaagttctcgagttagcgaagcatcgactaac
accagcaaaaaacctaaagttcctaaaacgtacaaaagaccaacttatttccgtaaaggc
gttagagataaggtttgggaaaatgctaaggattcaaccggatctgttaaagacccgtta
acaaaacaagtaatgaaaaaagatgaaccatgggatatgggtcataaaccaggttatgaa
tttagaaaacatcaacaaagtgcgatggaaagaaatattagtcgaaagcaatttttagat
gaacataataatccagaccactatcaacccgaattaccttcctccaataggagtcataaa
ggggaagatatgacggatgattactttggagattaa

DBGET integrated database retrieval system