KEGG   Bacillus subtilis subsp. subtilis 168: BSU25870
Entry
BSU25870          CDS       T00010                                 

Symbol
yqcF
Name
(RefSeq) hypothetical protein
  KO
K21492  antitoxin YqcF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU25870 (yqcF)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YqcG-YqcF
    BSU25870 (yqcF)
SSDB
Motif
Pfam: SUFU
Other DBs
NCBI-GeneID: 937785
NCBI-ProteinID: NP_390464
Pasteur: BG11297
BSORF: BG11297
UniProt: P45941 A0A6M4JL88
Position
2662712..2663290
AA seq 192 aa
MGVTQENKVIARTVLGAFGGKPKVTKYWDDNKNSSIDILSVSDQPQEGITSYSTLGLSDH
SINYEVNGTPLRIEIVAAMESASDIYANVLSTCAFNIINSNFTCAPGVIFKNVISMYDQE
TDMKHIMFVPPFLWEEDLELLEFSNKNVTWLMALPISEGELQVAEKHGSDYLQDLLESKQ
IDIFDIKRESVV
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggcgtaacacaagaaaataaagtaattgctagaacagttttaggagcttttgggggg
aaaccgaaggttacgaaatattgggatgataacaagaatagcagcatagatattttatcg
gttagtgaccagcctcaggaaggtatcacgtcatattcaactctaggtttgtcggatcat
tctattaattatgaggtgaatggcactccgttgcggatagaaatcgtagctgcaatggag
tcagcttcagacatatatgctaatgttttatcaacttgtgcctttaatataatcaactca
aatttcacttgtgcaccaggtgttatttttaaaaatgtgattagtatgtatgatcaggaa
accgacatgaaacatattatgttcgttcccccatttttatgggaggaagatttagaacta
cttgaatttagtaacaaaaatgttacttggctaatggctttacctatatccgaaggagaa
ttgcaagtagctgaaaaacacggctcagattatttacaagatcttctggaatcaaaacag
attgatatttttgatataaagagagaatctgttgtttaa

DBGET integrated database retrieval system