KEGG   Bacillus subtilis subsp. subtilis 168: BSU25880Help
Entry
BSU25880          CDS       T00010                                 

Gene name
yqxJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1878
Motif
Other DBs
NCBI-GeneID: 937786
NCBI-ProteinID: NP_390465
Pasteur: BG10507
BSORF: BG10507
UniProt: P24809
Position
complement(2663551..2663913)
Genome map
AA seq 120 aa AA seqDB search
MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYDLSEKQYQELRELTSQ
YTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGPEEGFGFSKALHNHFFN
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttggtaacagtagaagaaaggcttgacaacctagaaaaaaaagtcgagaagcaggctttt
caactaaggttagtccaacaattagcagctgattatgatcggtttggcttatttgatcaa
gttttggcctatgatttaagtgaaaaacagtatcaagaattaagagagttaacgagccag
tacactgataagattaaaaatggcgaagaggtctctcttcataactttactgaagaattt
aaaagaattttgaaagatattgaaaaagaagtggatttcgaaaagtttatttctctctgg
ttaaagggaccagaagaaggttttggattttctaaagctttacataaccatttctttaat
taa

DBGET integrated database retrieval system