KEGG   Bacillus subtilis subsp. subtilis 168: BSU25880
Entry
BSU25880          CDS       T00010                                 

Symbol
yqxJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1878 DUF2884
Other DBs
NCBI-GeneID: 937786
NCBI-ProteinID: NP_390465
Pasteur: BG10507
BSORF: BG10507
UniProt: P24809 A0A6M4JLM6
Position
complement(2663551..2663913)
AA seq 120 aa
MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYDLSEKQYQELRELTSQ
YTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGPEEGFGFSKALHNHFFN
NT seq 363 nt   +upstreamnt  +downstreamnt
ttggtaacagtagaagaaaggcttgacaacctagaaaaaaaagtcgagaagcaggctttt
caactaaggttagtccaacaattagcagctgattatgatcggtttggcttatttgatcaa
gttttggcctatgatttaagtgaaaaacagtatcaagaattaagagagttaacgagccag
tacactgataagattaaaaatggcgaagaggtctctcttcataactttactgaagaattt
aaaagaattttgaaagatattgaaaaagaagtggatttcgaaaagtttatttctctctgg
ttaaagggaccagaagaaggttttggattttctaaagctttacataaccatttctttaat
taa

DBGET integrated database retrieval system