KEGG   Bacillus subtilis subsp. subtilis 168: BSU25890
Entry
BSU25890          CDS       T00010                                 

Symbol
yqxI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937775
NCBI-ProteinID: NP_390466
Pasteur: BG10506
BSORF: BG10506
UniProt: P24812 A0A6M4JL18
Position
complement(2663929..2664408)
AA seq 159 aa
MFKKLLLATSALTFSLSLVLPLDGHAKAQEVTLQAQQEVTYQTPVKLSELPTNTTEQSGE
FHTNGIKKWIAKEAMKATASALRHGGRIVGEVVDELGGSAGKTFAKHTDDVADALDELVK
RGDVVEDAIIDTVSSYLIDAGVKSSTARTIASVFTFLAF
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtttaagaaattacttttagcaacatctgcattaacattctctttatcattagttctt
ccgttggatggacatgccaaagctcaagaggtaacattacaggcacagcaggaagtcact
tatcaaactcccgttaaactatccgaattaccaactaatacaactgaacaatctggtgaa
tttcacacaaatggtattaaaaaatggattgctaaagaagcaatgaaggcaacagccagt
gcgcttcgacatggtgggagaattgttggtgaggtagtcgatgagttaggtggatcagca
ggaaaaacattcgcaaaacatactgatgatgtagcagatgctttggacgagttagttaaa
cgaggtgacgttgtggaggacgcaattattgacacggtttcctcatatctaattgatgct
ggtgtaaaatcttctacagctagaactattgcaagtgtatttactttcttagctttttaa

DBGET integrated database retrieval system