KEGG   Bacillus subtilis subsp. subtilis 168: BSU25910
Entry
BSU25910          CDS       T00010                                 

Symbol
yqxH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_holin_4_1
Other DBs
NCBI-GeneID: 937782
NCBI-ProteinID: NP_390468
Pasteur: BG10504
BSORF: BG10504
UniProt: P24811 A0A6M3ZE70
Position
complement(2665436..2665858)
AA seq 140 aa
MEETSLFINFETLDLARVYLFGGVKYLDLLLVLSIIDVLTGVIKAWKFKKLRSRSAWFGY
VRKLLNFFAVILANVIDTVLNLNGVLTFGTVLFYIANEGLSITENLAQIGVKIPSSITDR
LQTIENEKEQSKNNADKAAG
NT seq 423 nt   +upstreamnt  +downstreamnt
atggaggagacaagtttgtttatcaattttgaaacattagatttagcaagagtatattta
tttggaggggtgaagtaccttgatttacttctagtacttagcataattgacgttttaaca
ggagtaatcaaggcatggaaattcaaaaaactgcgaagtcgaagcgcatggtttggctat
gtccgcaagctactcaatttctttgcggtcattttagcaaacgtgattgatacagtactc
aatttgaacggtgtcttaacctttggtaccgttcttttttatatcgctaatgaaggtttg
tcaataactgaaaacttagcacagattggtgttaaaataccatcatcaataacagatcga
ttacaaacaattgagaacgaaaaagaacagagtaagaataacgcagacaaagctgctggc
taa

DBGET integrated database retrieval system