KEGG   Bacillus subtilis subsp. subtilis 168: BSU25930
Entry
BSU25930          CDS       T00010                                 

Symbol
yqcE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_XkdX
Other DBs
NCBI-GeneID: 937759
NCBI-ProteinID: NP_390470
Pasteur: BG11296
BSORF: BG11296
UniProt: P45940 A0A6M4JNH8
Position
complement(2666884..2667048)
AA seq 54 aa
MNYWVLALHYNWASSEMVKQAIHLKDCSPEDLQEGIEKKLITAEQYKEITGEAI
NT seq 165 nt   +upstreamnt  +downstreamnt
atgaattattgggtgctggctttgcattataactgggcttcttctgaaatggtgaaacag
gcaattcatctcaaagattgttcgcccgaagatttacaggaaggaatagagaaaaaactc
attacagctgaacagtataaagagatcacaggagaagccatttag

DBGET integrated database retrieval system