KEGG   Bacillus subtilis subsp. subtilis 168: BSU25940
Entry
BSU25940          CDS       T00010                                 

Gene name
yqcD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: XkdW
Other DBs
NCBI-GeneID: 937768
NCBI-ProteinID: NP_390471
Pasteur: BG11295
BSORF: BG11295
UniProt: P45939 A0A6M4JJF1
Position
complement(2667045..2667380)
AA seq 111 aa
MNIGEAILFKYPTADPTKDFIVQNNGDGTPSYIAEWNIRAPIPTEAELKTWWEELQSTSA
YEPPVQVDLLARELSQEKLARKQLEELNQTLGSELSKIKLQLLTLQGGQGS
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaatataggtgaagctattctttttaaatacccaacagctgatcccacaaaggatttt
attgtccagaataatggtgatggaactccctcatatatagcagagtggaatattagggca
cctatacccacggaagcagagttaaaaacttggtgggaagagcttcagagtacatctgca
tatgaaccaccagttcaagtggatctacttgcaagagagttgtcacaggaaaaactggct
cgtaaacagcttgaagaattaaaccaaactttgggaagcgagctttcaaaaataaagttg
caactgcttactctacaaggagggcaaggttcatga

DBGET integrated database retrieval system