KEGG   Bacillus subtilis subsp. subtilis 168: BSU25950Help
Entry
BSU25950          CDS       T00010                                 

Gene name
yqcC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: C1q
Motif
Other DBs
NCBI-GeneID: 937773
NCBI-ProteinID: NP_390472
Pasteur: BG11294
BSORF: BG11294
UniProt: P45938
Position
complement(2667390..2668490)
Genome map
AA seq 366 aa AA seqDB search
MAYDAKTDWLPDDPINEDDVNRWEKGIQDAHKDLAVHKNDMNNPHNTTKAQIGLGNVDNV
QQASKKEFEEHRNDLQRHITPVERENWNAKETIVGAQEKADKALSDAKYYVDTNYKNNNL
TLITGDNAIQDARTGGEEYPLGLTLMDIGQGNTTGYPLGYGIVKNEKYNNYRFTQYFYGT
GNESGTYYDSTGVWIRHWWSGSGWTPWQKISGFAHANIGTTGVQYLKKIDHTKIAFNRVI
KDSHNAFDTKNNRFIAPNDGMYLIGASIYTLNYTSYINFHLKVYLNGKAYKTLHHVRGDF
QEKDNGMNLGLNGNATVPMNKGDYVEIWCYCNYGGDETLKRAVDDKNGVFNFFDIQELGG
RNYPRF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgatgcaaaaacagattggctcccggacgatccgattaatgaagatgatgtg
aaccgttgggagaaaggcattcaagatgcgcataaagatttagctgtacataaaaatgac
atgaacaaccctcacaatacaacaaaggcgcaaatcgggctagggaacgttgataatgta
cagcaagcttcgaaaaaagaatttgaagagcatcgtaatgatttacaacggcacattaca
ccagtggaacgggagaattggaatgcaaaagaaacaattgtcggagctcaggaaaaagcg
gataaggctttatcggatgcaaaatattacgtggataccaactataaaaataacaatctg
acgttaattactggagacaatgctattcaagatgcaagaacaggaggggaagaatatcct
ttaggactgaccttaatggacattgggcagggaaatactacaggctaccccttgggttat
ggcattgtcaaaaatgaaaaatataataattaccgtttcactcaatacttttacggaaca
gggaatgagtctgggacttactatgacagtacaggagtttggattagacactggtggagt
ggttcaggctggactccgtggcaaaagatatcaggttttgctcatgcgaatattggaact
acaggtgttcagtatttaaaaaagattgatcacactaaaattgcatttaacagggtcatc
aaggatagccataatgcttttgatactaaaaacaatcgatttattgctccgaacgatgga
atgtacttaatcggggcaagtatatataccttaaattatacatcttatataaactttcat
ttgaaggtttacctaaatggaaaagcatataaaacactgcaccatgtaagaggagacttt
caggaaaaggataatgggatgaatcttggtttaaacggcaatgcgactgtacccatgaat
aaaggagattacgttgaaatctggtgctactgtaattacggaggagacgaaacactgaaa
agggcagtagatgataaaaatggtgtatttaacttttttgatatacaagaacttggaggc
cgaaactatccaagattttag

DBGET integrated database retrieval system