KEGG   Bacillus subtilis subsp. subtilis 168: BSU25970
Entry
BSU25970          CDS       T00010                                 

Symbol
yqcA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_Mu_Gp48 DUF6730 Spike_torovirin
Other DBs
NCBI-GeneID: 937763
NCBI-ProteinID: NP_390474
Pasteur: BG11292
BSORF: BG11292
UniProt: P45936 A0A6M3ZEE1
Position
complement(2668762..2669340)
AA seq 192 aa
MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQLFVTTATWGLERWEK
ILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKNPSAQVRLLPGEYRFKV
DIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTVILNNRRYRKASELKVGY
SVTLNNNEVVLV
NT seq 579 nt   +upstreamnt  +downstreamnt
ttgagcaaactcgatgaaatgactgcttacctgccgccgttccttaccaagttaaaggaa
atggctgaacttcttaaagcggaagctccggaatttgagaagcaaaataacagcatcttt
gatctgacagatcagctgtttgttactacggcaacctgggggcttgaacgatgggaaaag
attttgaacgtaccgcgggaatcaggtgacaccgatgagatccgccgattgcgcctaatc
tctaaaatgtccaatataccgccggcaacatatagggccattgaacacgcgttgaaccgg
ttcctgaaaaatccgtcagctcaggttcggctgcttcccggagagtaccgttttaaggtt
gatattgatatagatgatatgcagcatatgagcgagctcatagaaacattggagaatatg
aagccagctcatttggcatataccttgcgagctgctttgaatgagccactccaaataaaa
gatactgtcattttgaataacagaaggtatcgaaaagcaagtgagctaaaggtaggttat
tccgtcacgctcaataataacgaggtggtccttgtatga

DBGET integrated database retrieval system