KEGG   Bacillus subtilis subsp. subtilis 168: BSU25970Help
Entry
BSU25970          CDS       T00010                                 

Gene name
yqcA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2313
Motif
Other DBs
NCBI-GeneID: 937763
NCBI-ProteinID: NP_390474
Pasteur: BG11292
BSORF: BG11292
UniProt: P45936
Position
complement(2668762..2669340)
Genome map
AA seq 192 aa AA seqDB search
MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQLFVTTATWGLERWEK
ILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKNPSAQVRLLPGEYRFKV
DIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTVILNNRRYRKASELKVGY
SVTLNNNEVVLV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaactcgatgaaatgactgcttacctgccgccgttccttaccaagttaaaggaa
atggctgaacttcttaaagcggaagctccggaatttgagaagcaaaataacagcatcttt
gatctgacagatcagctgtttgttactacggcaacctgggggcttgaacgatgggaaaag
attttgaacgtaccgcgggaatcaggtgacaccgatgagatccgccgattgcgcctaatc
tctaaaatgtccaatataccgccggcaacatatagggccattgaacacgcgttgaaccgg
ttcctgaaaaatccgtcagctcaggttcggctgcttcccggagagtaccgttttaaggtt
gatattgatatagatgatatgcagcatatgagcgagctcatagaaacattggagaatatg
aagccagctcatttggcatataccttgcgagctgctttgaatgagccactccaaataaaa
gatactgtcattttgaataacagaaggtatcgaaaagcaagtgagctaaaggtaggttat
tccgtcacgctcaataataacgaggtggtccttgtatga

DBGET integrated database retrieval system