KEGG   Bacillus subtilis subsp. subtilis 168: BSU25980
Entry
BSU25980          CDS       T00010                                 

Symbol
yqbT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Baseplate_J
Other DBs
NCBI-GeneID: 937758
NCBI-ProteinID: NP_390475
Pasteur: BG11291
BSORF: BG11291
UniProt: P45935 A0A6M3ZEJ1
Position
complement(2669324..2670370)
AA seq 348 aa
MFEDQTYESIMDRMLNSISADIDKREGSVIYNALAPVAAELAKSYIWLDTVLELVFSDTA
QGEFLDRRATEAGIERTAATKAVRAGEFTEGVTIPVGSRFYVDNLYFQYTADGTLECETA
GEAGNANISGQNLLSLDTIPGLQKAIVKEILIPGREEEDDDSLRARYFTRVRREAVSANK
AHYKQWAEEVDGVGKVKVFPLWNGDGTVKIVVTNANLEPASDILISKVKNYIDPEPGQGE
GQAPIGAFVTVESAVWKEVEISAEVLPEVNSSIDQVKQEIESGVLNLFKKIAFEDNVIRL
SQINNIVYNSPSVSDYADIKINGVAENLVLSAVEIPKLGQVNIIEQTR
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtttgaagatcaaacctatgaatcgattatggatcgaatgttgaacagcatttcagcg
gacattgataaaagggaaggcagcgtgatttataacgcgttagctcctgtagccgcagaa
ttggccaagtcttatatttggctcgatactgttctggaacttgtcttctcagacacggcc
caaggggaatttttagatcgacgagctactgaagcaggcattgagcggactgctgccaca
aaagcagtcagggcaggggagtttactgaaggcgtgaccattcctgtagggtctcgcttt
tatgttgataatctttattttcaatacacagctgacgggacgttggagtgtgaaacagcg
ggggaagcagggaacgcaaacatatccggtcagaatctattgtcattagacactatacct
gggcttcaaaaagcgattgtgaaagagattctgattcctggacgtgaagaagaggatgat
gacagtttaagagctagatattttacccgcgtgcgtcgagaagctgtcagtgccaataaa
gcacactataaacaatgggctgaagaagtagacggagtggggaaggtaaaggtctttccg
ctttggaacggggacggtacagtcaaaattgtcgtgaccaatgctaacttggaacctgct
tccgatattttaatatcaaaggtgaaaaactatattgatcctgaacccggacaaggtgag
ggacaagcgccaataggtgcctttgtcacagtggagagtgcggtatggaaagaggttgag
atttcagccgaggtacttcccgaggtcaatagctctatcgatcaggtaaagcaagaaatt
gaatcaggtgttttaaatctttttaaaaagattgcctttgaagataacgtcatccgttta
tcgcagattaataatatcgtctacaattcaccttcagtaagtgattacgcagatattaaa
atcaacggcgtggccgaaaatttggttctgagtgccgtcgaaatccctaaattggggcag
gtgaacatcattgagcaaactcgatga

DBGET integrated database retrieval system