KEGG   Bacillus subtilis subsp. subtilis 168: BSU25990
Entry
BSU25990          CDS       T00010                                 

Symbol
yqbS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2634
Other DBs
NCBI-GeneID: 937757
NCBI-ProteinID: NP_390476
Pasteur: BG11290
BSORF: BG11290
UniProt: P45934 A0A6M3ZE12
Position
complement(2670363..2670788)
AA seq 141 aa
MALSPEIEFEDIEDDSEVIETSQTYKIDFENGRITNEIITGLEAIKQFVYLSLHTERYAY
SVYSHDIGNELQDVLADNETTDAYKKMEIPRLIEEALIYDDRISAVTDFEIEKQGESFRV
SFTVETDEGTLEIEEVLGEDV
NT seq 426 nt   +upstreamnt  +downstreamnt
atggctttgtctccggaaatcgagtttgaggatatagaagatgacagcgaagtcatagag
acctcgcaaacctacaaaatagattttgaaaatggccgtatcacaaatgaaatcatcaca
ggccttgaagcgatcaagcagtttgtatatttgtctctccatactgagcgatacgcatat
tctgtttacagtcatgacattggaaatgaacttcaagacgtgctggcagataacgaaaca
acagacgcatataagaaaatggagatccctcggctgatagaggaagcactgatctatgac
gatcggatttctgctgttacagattttgaaatagaaaaacaaggcgaatcgttccgtgtc
tcctttacagtcgagactgacgaaggaacattggagatcgaggaggtgcttggcgaggat
gtttga

DBGET integrated database retrieval system