KEGG   Bacillus subtilis subsp. subtilis 168: BSU26010
Entry
BSU26010          CDS       T00010                                 

Symbol
yqbQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5707 DUF1428 DUF4974
Other DBs
NCBI-GeneID: 937751
NCBI-ProteinID: NP_390478
Pasteur: BG11288
BSORF: BG11288
UniProt: P45950 A0A6M4JJR7
Position
complement(2671061..2672041)
AA seq 326 aa
MIELFVIKETEWLELVTESVSLEGQRYQAPRSITAKIITKQGTHSYYSVSEGDTVLFKWK
GKELFRGIVFSRNPEEHWMTFTAYDMLQYLVKNKDVYVFSNQRADEIIKRLARDFQIPTT
SIANTGYTIKSLVFKDDTSLYDMILKALKQTKSQTGRNYQLYSAKGKLGLRAWPDLSEVW
VLETGVNITGYQYSTSINDTATKVKLRRQKDNKTYTATASDSSGISKYGVLQYVETVSDN
INQAQLQERAKVKQAQKKGVKKELKSIQAIGIPDLQSGLPIYISIPEVGVKKTYWIDTDK
HEFKGSTHTMTIDVVEKNSIPDGVSS
NT seq 981 nt   +upstreamnt  +downstreamnt
atgatagaacttttcgtcattaaagaaacggaatggcttgagctggtaactgaaagtgtt
tccctcgaagggcaacggtatcaggcgccgcgatcgattacggccaagatcattacgaaa
cagggaacccattcatattacagcgtatctgaaggggatacagttttatttaagtggaag
ggcaaagaactgttccggggcattgtgttttctcgcaatccggaagaacactggatgact
tttacggcttatgatatgctgcaatatttggtcaagaacaaagatgtttatgttttctca
aatcaacgtgcagacgagattataaaacggttggcgcgagattttcagattccgactaca
tccattgcaaatacaggttacaccattaaatcattagtgtttaaagatgatacgagcctt
tatgacatgattctaaaagccttgaaacaaacgaaaagccaaaccggaaggaattatcaa
ttatattctgcgaaggggaagcttggccttcgcgcttggccagatctgtcagaagtatgg
gtgttggagacgggtgtgaacatcaccggctatcaatacagcacttcaattaatgacacg
gccacaaaagtaaagctccgccggcagaaagacaataaaacatacacagccactgcaagt
gacagctcagggatcagtaaatatggtgtgcttcagtatgtcgaaacggtttctgataac
attaaccaggcgcagcttcaggagcgtgcgaaagtcaaacaggcacagaaaaaaggtgtt
aaaaaagaactcaagagtattcaagcgattggcattccggatcttcagagcgggttgccc
atctatatctcaattccggaagtcggggttaagaaaacatactggatcgatacagacaaa
cacgaatttaaaggatcgacacacacgatgaccattgatgtggttgagaaaaattctatc
cctgatggtgtttcctcatga

DBGET integrated database retrieval system