KEGG   Bacillus subtilis subsp. subtilis 168: BSU26020
Entry
BSU26020          CDS       T00010                                 

Symbol
yqbP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysM TcpQ Stm1_N
Other DBs
NCBI-GeneID: 937756
NCBI-ProteinID: NP_390479
Pasteur: BG11287
BSORF: BG11287
UniProt: P45932 A0A6M3ZHG7
Position
complement(2672054..2672713)
AA seq 219 aa
MTKSIYEFWISQGKDKLRLPVLPEQIDISNTIQNESVKVASFGEITFIDKPGAKEISFSS
FFPKKHSPLAEYKGFPSPENAIAKIEKWVKSKKPVQFLITGTKINLTCSIEVFSYTEGQK
DIGDRDYEIKLKEYKTASPRKIKQKKKTKKKRPSKSAPKTYTVKKGDTLWDLAGKFYGDS
TKWRKIWKVNKKAMIKRSKRNIRQPGHWIFPGQKLKIPQ
NT seq 660 nt   +upstreamnt  +downstreamnt
ttgactaaatccatatatgaattctggatttcacaagggaaggacaagctgcggcttccg
gtccttcctgaacaaattgatatatccaacacaattcaaaatgaatcagtaaaagtggct
agttttggggagatcacttttattgataaaccgggagcgaaagaaatttcgttctcttct
ttttttccaaagaaacacagcccgcttgctgagtataagggatttccttctcctgaaaat
gctattgcaaagatcgagaaatgggtgaaatctaaaaagccggttcaattcttaattact
ggaacgaaaattaatttaacttgcagtatcgaggttttttcttatacagagggccaaaaa
gatataggtgatcgtgattatgaaataaagctgaaggaatacaaaactgcttcgccgcgg
aagatcaagcagaagaaaaagacgaagaagaaacggccatctaaatcagctcctaaaaca
tacaccgttaagaaaggcgatacactgtgggaccttgccggcaaattttatggagacagt
acaaaatggcgcaagatatggaaagtcaataaaaaggctatgatcaaacgaagcaaacgg
aatataagacagccaggacactggatctttcctgggcaaaaattaaaaataccgcagtaa

DBGET integrated database retrieval system