KEGG   Bacillus subtilis subsp. subtilis 168: BSU26030
Entry
BSU26030          CDS       T00010                                 

Symbol
yqbO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SLT PhageMin_Tail TMP_3 HisKA_3 DUF4062
Other DBs
NCBI-GeneID: 937747
NCBI-ProteinID: NP_390480
Pasteur: BG11286
BSORF: BG11286
UniProt: P45931 A0A6M3ZEE3
Position
complement(2672706..2677463)
AA seq 1585 aa
MAKLTATFELHDKISRKLRMIQGNAERLKRAANGPLIFEAEDRTERVMRQIDRSANRLTA
RARLLEMGLDDRVSNGLHSIRQQAEDLTEGSHEVTVSVNDQATPRFRLIRGGLTDLNSSH
AEPTVSVRDHASNQLDEIRRHVTDVDSEHAEPTVSIKDRASAALDAIEAKIDSLKGATIT
LAVAGGFSAGSIMGSGKSTMSQDAYVSATSNVNKKDVAKMTDQIYFNNKAGSSREEVSLS
LRNLSQQTGASKKALAELTESSSKIAQLMNADQAEVDRAFSSMYNNLKLSGKQSGDLIAY
VYRNAGDQADDLLDTMNEYSSTFKDLKLTGGQIANAMIKGTKGGARNFDNLADSMREFNI
RRTEMSDSQVDAFKTLFGAKETKKMFKGFKDGSISGEESLFRVAKALSKVKDKTKRAAIA
TELIGTQYEDLKQPILDMAEGIGTSAKTSGELERSFTKLRDNNPMTPVNDAMRDFESISK
DMGTSLLTGLGPAFDKISSFINSKEGQEKLKEIKKDIADLGEEIGDKLNVAIEWSVNHWD
DLKTAIKVVIPSLIGLIGYLKILRPLLKGIGTVGSDAAGVIRKLIPKRTPKAGTNTQSER
RNRNSNRNASTRGRESKTATGPTSLPRSGSLTYCCCSDGGKNDRIRRRRGKRVLGRRGNP
NRMNPSDSSIAVSSERLERRRSGRTVGTNPTRDSRSAIITTRSELYSAGRAAGGTSKFGK
VLSPLKSVGKFAKGVPLLGTALAATDLIGMNKDNVGEKIGSAGGGLAGAATGAAIGSVIP
GVGTAIGGLVGGIAGTMGGSSLGKAFDGSEVKKKLNSTLFDQKWWSEKWSGIKSNAKTSI
NGLSDTWSNVKEKVKSTLFNSEWWSEKWSGVKSWAQNKWNSASSVWESVKGKIKSTLFSE
KWWSGKWEGVKSWAQSKWDSASSVWQSVKGKLKSTLFSEKWWSGKWESVKSWSKNKWDNA
KSIWKSVKSSISETLFSKKWWSEKWQSVKELGSSILGGVKEVGGKVASSAKKTAGKAWGY
VKSGVNYLFGSGKEKPKKHATGGYITKPTISWIGEAGKEFVIPVENNKGRGKMLLSQAAS
KLGMSVVDDIASASSAGGEPATSPLVRSAAVTASVSPIIDTSSLDEQATSFGQQFTKSFD
QGIRDNVVSMEAWKQKNVGQPMNNLISYSPNYGKQVVNGYAKGQNSTSTGTDGFLQTKVK
MPFQNTVNKSSSWGSGTIKGFASGQNSSQTGTDQYVSTHINKPFIRSKESSNGWGSGMIG
NFVSGMTSKASEVNEAAKELAKKVEKAFREELDIHSPSRVMMSLGRFASIGIVKGLDSVD
VKKFAEKQAGSLAAAYSGMGAVSGNVKQWLMAAIMATKTPMSWLPGLMTIAQHESGGNPK
AINLWDSNAKAGHPSQGLMQTIPSTFNAHKLPGMNNILNPIHNAAAAIGYIKSRYGSINN
VPGIRSMRHGGPYVGYANGGLITKEQIARVGEGNKREWIIPEERGIRGRYLLAQAAKALG
MEVTDPSEKGQTELSSGQVTAATTGRNQTTFKAAGGKEVIIQFNGDQHFHNDQDMNSLVA
KIKQALVDELEQDINIGTKGVVAFD
NT seq 4758 nt   +upstreamnt  +downstreamnt
atggctaaactaacagccacgtttgaattacatgataagatttcccgcaagcttcgaatg
atacaaggcaatgctgaaagacttaagagggctgctaatggccctcttatttttgaggct
gaagaccggactgaaagagttatgcggcaaattgatcgatcagccaaccgtttgacggct
cgggctcgattgcttgaaatgggtttagatgatcgagtttcgaatggcttacattctata
cgccagcaagcagaggatcttaccgaaggcagtcatgaggtgacggtttccgtaaatgat
caagctacaccacgttttcgtttgatccgtggaggtctcactgatttgaatagctcgcac
gctgagccaactgtttcagtacgtgatcatgcttctaaccaattagatgagatccgtcgt
catgtgactgatgtagatagcgaacatgcagagccaactgtttctattaaggatagagct
tcagcggctctggatgctattgaagcgaaaatagacagcttgaagggtgctaccattact
ctggcagttgcaggtggtttttctgcaggttcaattatgggttctggtaaaagcacaatg
tctcaggatgcttatgtgtcagcaacttcaaacgttaataagaaagatgttgcaaaaatg
acggatcagatctatttcaacaataaagcgggcagttctcgggaagaagtcagtttatct
ctaagaaacttatcgcaacagacaggggcgtctaaaaaagctctggctgaattgactgag
tcatcaagtaagattgcccagcttatgaatgctgatcaggcagaggtagatcgtgctttc
agttcaatgtataacaacttgaaattgtctgggaaacaaagcggagacttaattgcttat
gtataccggaatgccggtgaccaggctgatgatttattagacacgatgaatgaatacagt
tccacctttaaagacttgaagctcacaggcggccaaattgcaaacgcgatgataaaagga
acaaagggtggagccagaaacttcgataacctagccgatagtatgcgtgagtttaacatc
cgccgaaccgaaatgtctgatagtcaagtggacgcatttaaaacactgttcggagccaag
gaaactaagaaaatgttcaagggcttcaaagatggttcaataagcggagaggaaagttta
tttagggtggcaaaagccctttctaaagtgaaagacaaaacaaagcgggctgctattgcg
actgagcttatcgggacacaatatgaagaccttaagcagcctattttagatatggctgag
ggtattggtacaagtgccaaaacaagcggtgaattggaacgaagctttacgaaacttcgg
gataataacccgatgacaccggttaatgatgccatgagagattttgaaagcatatctaag
gatatgggaacctctctgctaactggattaggaccggcctttgataaaatcagctcgttc
attaacagtaaagaaggtcaggaaaaacttaaagagatcaaaaaagatattgctgatcta
ggtgaggagataggtgataagttaaacgtagccattgagtggagcgtcaaccattgggat
gatttgaaaacagcgattaaagttgtgatcccctctttaattggattgattggttatttg
aaaatacttcgtccgctgttaaaaggcataggtactgtcggaagtgatgcagcaggcgta
atccgaaaattaattccaaaacgtactcctaaagctggtactaatacgcaaagtgaaagg
aggaatagaaacagtaatcgtaatgctagcacaaggggcagagaatccaaaactgccaca
ggtccaacgagtttacctcgaagcggcagcttgacatattgctgttgtagcgatggaggt
aaaaatgatcgcattcgtagaagacgagggaaaagagttttaggtcgacgcggtaatcca
aaccgaatgaacccttctgatagttcaattgctgtgtcatctgaacggttggagagaagg
cgttccggtagaactgtaggtactaatccaactagagattcaagatcagcaataatcact
acgagatcggagctatactcagctggtagagctgcaggcggtacatcgaagttcgggaaa
gtcttaagtcctctgaaaagtgttggcaagtttgcaaagggagtccctctattaggaaca
gcgttagcggcaaccgatttaattgggatgaataaagataatgttggtgaaaaaattgga
tcagctggcggtggccttgctggagcggctacaggagcagctattggcagtgttattcca
ggagtgggaacagctattggtggattagttggtggtatagcaggcaccatgggcggctca
agtttaggtaaagcgtttgatggttcagaagtaaagaagaaactaaacagtacattattt
gatcaaaaatggtggtctgaaaaatggtcaggcattaagagtaatgcgaagacttccatc
aatgggttaagtgatacatggtctaatgtaaaagaaaaggtgaagtccactttatttaat
agtgaatggtggtctgaaaagtggtctggcgttaaaagctgggcacaaaacaaatggaat
agtgcatcatctgtttgggagtccgtaaagggaaaaataaaatccactttgtttagtgag
aagtggtggtcaggtaaatgggaaggcgtaaaaagttgggctcaaagtaagtgggacagc
gcgtcttctgtttggcaatcagttaaaggaaagctgaaatccactctatttagcgagaag
tggtggtcaggaaaatgggaaagtgtaaaaagctggtccaaaaataaatgggacaatgct
aaatcaatatggaaaagtgttaagagttccatctcagaaaccctttttagtaagaagtgg
tggtctgaaaagtggcagagtgtaaaggaattgggaagcagtattttaggcggggtaaaa
gaagttggtggtaaagtagcttcaagtgcgaaaaaaactgctggtaaagcgtggggatat
gtgaagagtggcgtaaattatttatttggttcgggaaaagaaaagccaaagaaacatgct
actggtggttacattacgaagccaacaatatcttggattggtgaagctggtaaagaattc
gttatccctgttgagaataataaaggtcgcggcaaaatgctcctttctcaagctgcttcg
aaattagggatgagtgtggttgatgatatagcgtctgcttcatctgcaggaggtgaaccg
gcaacttccccgctagtccgtagtgcggcggtgactgcttctgtatctcctattattgac
acatccagtcttgatgaacaagcaacatcatttggtcaacagttcacgaagagctttgat
caaggaattagagataatgttgtttctatggaagcatggaaacagaaaaacgttggacaa
ccaatgaacaatttaatctcttattctccgaattacggaaagcaagtggtcaatggttat
gctaaaggtcaaaacagcacttcgaccggtacagatggcttcttgcagacgaaggttaaa
atgccatttcagaacactgttaataaatcttcatcatggggaagcggaacgatcaaaggt
tttgcttccggacaaaatagctcacaaactggtactgatcaatacgtcagcactcatatt
aacaagccgtttatccgctctaaagaatcatcaaacggatggggaagcggtatgatcggt
aattttgtttcaggcatgacttctaaggcaagtgaagtcaatgaggctgccaaggaactg
gcgaaaaaagttgagaaggcatttcgtgaagagctggatattcattcaccttcccgtgtc
atgatgagtcttgggcgttttgcctctataggtattgtaaaaggtctggattctgttgat
gtaaaaaagtttgctgaaaaacaagcaggctcactagctgccgcttattctggaatgggc
gcagtaagcggaaatgtgaagcaatggctcatggctgctatcatggctacaaagacaccg
atgagctggcttccagggctgatgacaattgctcagcatgagtcaggcggtaatccgaag
gcaatcaacttatgggatagtaatgcgaaagcaggacatccatctcaggggctcatgcag
acaatcccaagtaccttcaacgcacacaaattgccgggcatgaataacattcttaacccg
attcacaacgctgctgctgcgattggctatatcaaaagcagatatggatcaattaataat
gtaccaggcattagaagcatgagacatggaggtccatatgttggctacgctaacggcgga
cttattaccaaagagcagattgcccgtgtcggtgaaggaaacaaaagggaatggatcatt
ccggaggagcgaggcatccgtggacgttatttattagcccaagcagctaaggcactcgga
atggaagtcacagacccatctgaaaaaggtcaaactgaattatcttcaggtcaggtaaca
gctgccacaacgggtcgtaatcaaacaacgtttaaagctgcaggtggcaaagaggtcatt
attcagtttaatggcgatcagcattttcacaatgaccaagacatgaacagtcttgtagct
aagattaagcaggcccttgtcgatgagcttgaacaggatatcaacattggaacgaaggga
gtcgttgcttttgactaa

DBGET integrated database retrieval system