KEGG   Bacillus subtilis subsp. subtilis 168: BSU26050
Entry
BSU26050          CDS       T00010                                 

Symbol
yqdB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Hol_Tox DUF2417
Other DBs
NCBI-GeneID: 8303122
NCBI-ProteinID: NP_390482
Pasteur: BG11512
BSORF: BG11512
UniProt: P54373 A0A6M4JLA8
Position
2678240..2678419
AA seq 59 aa
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
NT seq 180 nt   +upstreamnt  +downstreamnt
atgtcgacctatgaatctctaatggtcatgatcggctttgccaatttaataggcgggatt
atgacatgggtaatatctcttttaacattattattcatgcttagaaaaaaagacactcat
cctatttacattactgtaaaggaaaagtgtctacacgaggaccctcctattaaagggtag

DBGET integrated database retrieval system