KEGG   Bacillus subtilis subsp. subtilis 168: BSU26060
Entry
BSU26060          CDS       T00010                                 

Symbol
yqbM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2001 IHO1 Laminin_G_3
Other DBs
NCBI-GeneID: 937740
NCBI-ProteinID: NP_390483
Pasteur: BG11284
BSORF: BG11284
UniProt: P45929 A0A6M4JLN9
Position
complement(2679142..2679585)
AA seq 147 aa
MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGT
ATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERVTLYDVNFDSAKIAGLD
VDSEALEEEVPFTFEDFDVPEQLKSTF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcattaaaagcgcaaaacaccatttcaggtaaagagggcaggttgtttcttgatgga
gaagaaatggcccatatcaaaacgtttgaagccaatgtagagaaaaacaaatccgaggtc
aatatcatgggtcgtcggatgacggggcacaaaacgaccggagcaaatggaacgggaaca
gccactttttataaagtgacttctcaatttgttcttattatgatggactatgtgaaaaag
ggaagtgatccttatttcaccttacaagctgttctagatgacgcctcttcaggtcgtggg
actgaacgagtcaccttgtacgatgtgaactttgattctgcgaaaatcgctgggcttgat
gttgattctgaagcattggaagaagaagtgccgtttacctttgaggattttgatgtgcct
gaacagttaaaatccacattctaa

DBGET integrated database retrieval system