KEGG   Bacillus subtilis subsp. subtilis 168: BSU26060Help
Entry
BSU26060          CDS       T00010                                 

Gene name
yqbM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2001 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 937740
NCBI-ProteinID: NP_390483
Pasteur: BG11284
BSORF: BG11284
UniProt: P45929
Position
complement(2679142..2679585)
Genome map
AA seq 147 aa AA seqDB search
MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGT
ATFYKVTSQFVLIMMDYVKKGSDPYFTLQAVLDDASSGRGTERVTLYDVNFDSAKIAGLD
VDSEALEEEVPFTFEDFDVPEQLKSTF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaagcgcaaaacaccatttcaggtaaagagggcaggttgtttcttgatgga
gaagaaatggcccatatcaaaacgtttgaagccaatgtagagaaaaacaaatccgaggtc
aatatcatgggtcgtcggatgacggggcacaaaacgaccggagcaaatggaacgggaaca
gccactttttataaagtgacttctcaatttgttcttattatgatggactatgtgaaaaag
ggaagtgatccttatttcaccttacaagctgttctagatgacgcctcttcaggtcgtggg
actgaacgagtcaccttgtacgatgtgaactttgattctgcgaaaatcgctgggcttgat
gttgattctgaagcattggaagaagaagtgccgtttacctttgaggattttgatgtgcct
gaacagttaaaatccacattctaa

DBGET integrated database retrieval system