KEGG   Bacillus subtilis subsp. subtilis 168: BSU26075
Entry
BSU26075          CDS       T00010                                 

Symbol
yqbK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_sheath_1 Phage_sheath_1C Phage_sheath_1N
Other DBs
NCBI-GeneID: 937738
NCBI-ProteinID: NP_390485
UniProt: P45927 A0A6M4JL37
Position
complement(2679588..2680988)
AA seq 466 aa
MNGGTFTPGKEKERAGIYFNFKTTAENRVSAGERGTVALPIASSWGEVKKFISISSIEDL
NKKVGLNIDDPSLLLLREAMKKANTVLLYRLTEGLRASADISEGVKATALYGGTKGNDII
ISITENVIDSSKVDVTTYLDQSEVDKQTVSKAEELKPNKYVTFTGKGDLTVTIPLTGTAP
EDVSGALPATSGIRLSGGTDKTPTNADYTAFLEAAETEYFDTIALPVEDNEQLKATFVAF
IKRLRDNQGQKVQGVLSNYKGDHEGIINVTGGVLLEDGTEITPEKATAWVAGASAGATFN
QSLTFVEYEGAVDVLNRIDNDEIVERLSNGEFLFTYDSRDKSVSVEKDINSLTSLTAEKN
KMFQKNKIVRVLDAINNDLTSQLKALIKSRKASGSDVPATNDGLQFVKTLITQYLSVLQD
NEGITDFDSENDITIALNNDRDGFLIDLAVQPVDAAEKFYFNVEVK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaacggcggaactttcacacctggcaaggaaaaagagcgtgccggtatttactttaac
ttcaaaacgaccgcggagaaccgtgtttctgccggagaacgtggaacagtggcgctgccg
atagcgtccagctggggtgaggttaagaaattcatttctatctcttcaatcgaggacttg
aataaaaaagtggggttgaacattgatgatccttcgctgttgcttttacgtgaggcgatg
aagaaggcgaatacagtcttgctttatcgcctaacggaaggtcttcgtgcttcagcagac
attagcgaaggtgtaaaggctactgctctttatggcggcactaaaggtaatgacatcatt
attagtattacggagaacgttattgactcttcgaaagttgatgtcactacctaccttgat
caatctgaagtggataaacaaacagtgtctaaagctgaagaacttaaaccgaataaatat
gtcacgtttacggggaaaggagatttaacagttactattccgttaaccggtacggcccct
gaagatgttagcggtgctctccctgcaacttccggaatccgcttgtcaggcggaacagac
aaaacaccgacaaatgccgattatacagctttcttggaagcggctgaaacggaatacttt
gacacaatcgctttacctgtagaggataacgagcaattaaaagcaacgtttgttgcgttt
atcaaacggctgagagacaaccaagggcaaaaggttcaaggtgttctttcaaattacaag
ggagaccatgagggtattatcaatgtaacaggtggtgtcctacttgaggatggaacggag
atcactcctgaaaaagctacagcttgggttgccggtgcaagtgcgggggctacatttaat
caatcacttacatttgtagaatacgagggagctgtagatgtccttaaccgaattgacaac
gacgaaatcgttgaacgattgtcaaatggggaattcttgtttacttatgattctcgtgat
aaatcagtatcggttgaaaaggacattaattcactcacaagcctaacagcagagaaaaat
aagatgttccagaaaaacaaaattgtccgtgtacttgatgcaatcaataatgacctgaca
tcacaattgaaagcattgatcaagtctcgaaaagcgagcggcagtgatgttcccgctaca
aatgacggactgcagtttgtaaaaacgctaattactcaatacttgagtgttcttcaagat
aacgagggcattactgattttgattcagagaatgacattacaattgctctgaataatgat
cgtgacggcttcctgattgatcttgcagttcaaccggtggatgcagctgaaaaattctac
tttaatgttgaggtgaaatag

DBGET integrated database retrieval system