KEGG   Bacillus subtilis subsp. subtilis 168: BSU26089
Entry
BSU26089          CDS       T00010                                 

Symbol
yqzN
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_DsbA
Other DBs
NCBI-GeneID: 8303132
NCBI-ProteinID: YP_003097763
UniProt: C0H454 A0A6M4JMK9
Position
complement(2680989..2681180)
AA seq 63 aa
MMATKKEKAENAFYIKDLREHSRELFGVKPEVFDGALFHVHKMSITKSEAKKLISQFLQK
EVK
NT seq 192 nt   +upstreamnt  +downstreamnt
atgatggccactaaaaaagagaaagcagaaaatgctttttatattaaggatttgcgagag
cacagtcgagagctctttggggtaaaacccgaggtgtttgacggtgctctttttcatgtt
cataaaatgagtattacaaaatcggaagcgaagaagttgatttctcagtttcttcaaaag
gaggtcaaatag

DBGET integrated database retrieval system