KEGG   Bacillus subtilis subsp. subtilis 168: BSU26090
Entry
BSU26090          CDS       T00010                                 

Symbol
yqbJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937746
NCBI-ProteinID: NP_390486
Pasteur: BG11281
BSORF: BG11281
UniProt: P45926 A0A6M4JJT0
Position
complement(2681177..2681614)
AA seq 145 aa
MNQEVGSIMGYLYKLYPVQVYEEEIPQDFAVPSLYFPPASTVDGVDTVSTFQKAYVLNVK
LFHENVQKAHNEAERIADTLRSRRGIIPLIQESGEDTGDFIRLSRIETRVSDDYATIVLN
WTSRYWYEREDQRSIDGFKFKSGVK
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaatcaagaagtaggttcaattatgggctatctatacaaactgtatcctgttcaagtg
tatgaagaagaaataccgcaggactttgctgttccgtctctttactttccaccggcttcc
acggtcgatggggtggacacagtatccacgtttcagaaagcatatgttttaaacgtaaaa
ctctttcacgaaaacgtacagaaggctcataacgaagcggaacgaattgcggatacactt
agaagcagaagaggcataattccgcttatacaagaatctggcgaggatactggggatttt
attcgcctatctcgaatagaaacgcgggtatcagacgattatgcgaccattgtcttaaac
tggacgagccgctattggtatgagcgggaagatcagcgttcaatagatggttttaaattt
aaaagtggggtgaaatga

DBGET integrated database retrieval system