KEGG   Bacillus subtilis subsp. subtilis 168: BSU26100Help
Entry
BSU26100          CDS       T00010                                 

Gene name
yqbI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HK97-gp10_like MoeA_C
Motif
Other DBs
NCBI-GeneID: 937737
NCBI-ProteinID: NP_390487
Pasteur: BG11280
BSORF: BG11280
UniProt: P45925
Position
complement(2681627..2682130)
Genome map
AA seq 167 aa AA seqDB search
MKIRGLDQFIQSLDRASRGGLKRKYEQWLESMGFEFLDIIQDEIIRTKTVDTRRLLNSFQ
KGDQDNIFSMTEGSLKLDVGTNLDYASYVNDGHFTIDPSKNQDRRWVPGRWKGDRFEYDP
AEKNSGMLLKFRWVDGSGFWDNAMAIFQLMFERSLERKLQQWIYEEF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcggggtctcgatcagttcatacaatcattagaccgggcttctcgtggggga
ctgaagaggaaatatgagcagtggcttgaatcaatgggttttgagttcttagatatcatc
caagatgagatcattaggacgaagaccgtggacactcgccgcttgctcaattcctttcag
aaaggtgaccaggataatatcttttcaatgacagaaggcagcttaaagttggatgttgga
acaaatctggattacgcctcatacgtcaatgacgggcactttactatcgatccgtctaaa
aatcaggatagacgatgggttccaggtcggtggaaaggcgaccgtttcgaatatgaccct
gctgaaaaaaattccggcatgctgctgaagttccgatgggtagacggttcggggttttgg
gataacgccatggccatttttcagttgatgtttgagagaagccttgagcggaagctgcag
caatggatttatgaagaattttaa

DBGET integrated database retrieval system