KEGG   Bacillus subtilis subsp. subtilis 168: BSU26120
Entry
BSU26120          CDS       T00010                                 

Symbol
yqbG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3199
Other DBs
NCBI-GeneID: 937739
NCBI-ProteinID: NP_390489
Pasteur: BG11278
BSORF: BG11278
UniProt: P45923 A0A6M4JJH0
Structure
Position
complement(2682486..2682881)
AA seq 131 aa
MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDFSDAEYIPLPETVRLA
LLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSSLQKPDVYALIKDYVKPADPDLE
GIEAKVRMRSI
NT seq 396 nt   +upstreamnt  +downstreamnt
atgctgttaatcactcccgatgaattaaagagttattcagtttttgagtctgtaaagacc
agacctgacgagttgttaaaacaggatatccttgaggcaactgccgatatcattcttaaa
gttggacatgatttttcagatgcagagtatatccctttgcctgaaacggttcgactggct
ctattaaagttgtctcagttttatgctcttataaatggcgacgagtcaattattaaagga
tatacaactgaaaaaattggtgactattcttatactctaggggatggcagttctcttcaa
aaacctgatgtgtatgcattaataaaagattatgtgaaaccggctgaccctgatttagaa
gggattgaagcgaaagtgcggatgagatcaatatga

DBGET integrated database retrieval system