KEGG   Bacillus subtilis subsp. subtilis 168: BSU26120Help
Entry
BSU26120          CDS       T00010                                 

Gene name
yqbG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3199
Motif
Other DBs
NCBI-GeneID: 937739
NCBI-ProteinID: NP_390489
Pasteur: BG11278
BSORF: BG11278
UniProt: P45923
Structure
PDB: 

Position
complement(2682486..2682881)
Genome map
AA seq 131 aa AA seqDB search
MLLITPDELKSYSVFESVKTRPDELLKQDILEATADIILKVGHDFSDAEYIPLPETVRLA
LLKLSQFYALINGDESIIKGYTTEKIGDYSYTLGDGSSLQKPDVYALIKDYVKPADPDLE
GIEAKVRMRSI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaatcactcccgatgaattaaagagttattcagtttttgagtctgtaaagacc
agacctgacgagttgttaaaacaggatatccttgaggcaactgccgatatcattcttaaa
gttggacatgatttttcagatgcagagtatatccctttgcctgaaacggttcgactggct
ctattaaagttgtctcagttttatgctcttataaatggcgacgagtcaattattaaagga
tatacaactgaaaaaattggtgactattcttatactctaggggatggcagttctcttcaa
aaacctgatgtgtatgcattaataaaagattatgtgaaaccggctgaccctgatttagaa
gggattgaagcgaaagtgcggatgagatcaatatga

DBGET integrated database retrieval system