KEGG   Bacillus subtilis subsp. subtilis 168: BSU26130
Entry
BSU26130          CDS       T00010                                 

Symbol
yqbF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqbF D123
Other DBs
NCBI-GeneID: 937735
NCBI-ProteinID: NP_390490
Pasteur: BG11277
BSORF: BG11277
UniProt: P45922 A0A6M3ZET0
Structure
Position
complement(2682885..2683196)
AA seq 103 aa
MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQKDDPINYTES
ELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE
NT seq 312 nt   +upstreamnt  +downstreamnt
gtgtttactgcaaagcttattaaaggcaaaacatacaatgtgatgggaataacctttcga
gcaggtgtcagtcaaacagtaccgaaaaagctctatgagtatttaaatgaaaatccatat
tttatactaacccaagagcttaataatcaaaaggatgatccgataaattatactgaatcg
gaattgaaaggtatgaataaagcagagcatgaatccattatttctaatcttggtcgcaat
ccgtctgacttcaaaaacgcagatgaaagaattgcctacatccttaagcaaatagataac
aaaggggagtga

DBGET integrated database retrieval system