KEGG   Bacillus subtilis subsp. subtilis 168: BSU26130Help
Entry
BSU26130          CDS       T00010                                 

Gene name
yqbF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqbF D123
Motif
Other DBs
NCBI-GeneID: 937735
NCBI-ProteinID: NP_390490
Pasteur: BG11277
BSORF: BG11277
UniProt: P45922
Structure
PDB: 

Position
complement(2682885..2683196)
Genome map
AA seq 103 aa AA seqDB search
MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQKDDPINYTES
ELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
gtgtttactgcaaagcttattaaaggcaaaacatacaatgtgatgggaataacctttcga
gcaggtgtcagtcaaacagtaccgaaaaagctctatgagtatttaaatgaaaatccatat
tttatactaacccaagagcttaataatcaaaaggatgatccgataaattatactgaatcg
gaattgaaaggtatgaataaagcagagcatgaatccattatttctaatcttggtcgcaat
ccgtctgacttcaaaaacgcagatgaaagaattgcctacatccttaagcaaatagataac
aaaggggagtga

DBGET integrated database retrieval system