KEGG   Bacillus subtilis subsp. subtilis 168: BSU26150
Entry
BSU26150          CDS       T00010                                 

Symbol
yqbD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_S78_2 Syntaxin_2 SQHop_cyclase_C DUF1741 Lant_dehydr_C DUF3007
Other DBs
NCBI-GeneID: 937736
NCBI-ProteinID: NP_390492
Pasteur: BG11275
BSORF: BG11275
UniProt: P45920 A0A6M4JM25
Position
complement(2684161..2685129)
AA seq 322 aa
MPRELVNAKITHVSYVDKAANQKQFFIVKSEKQPDFQKEVRILAKEADEQKLVYGIVYEP
DTVDAHGDFMTAAEIEKAAHGFLKDARQIDKQHDFQGGVGEVVESYVAPADFEMNGETIK
KGSWVLVTKASEEVWEQIKKGEITGYSMAGTAETIEKQEKPVSQEKTDEKGLFNLLKNFF
VGKQQQSYEEPVAKAGRKFSASNLQEIKNAHAALGNLLSQVETKEGEEEMTSEEVTKSIQ
EALEPIKKRLETLEKEEELNKKDKEKEEETEKEGEKLKKAISEAVQPLADRIEAIEKSRG
TSKQTEESGSEQVQKSIWSGLF
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccaagagaattggtgaacgcaaaaatcacacatgtttcttatgtggataaggctgct
aatcaaaagcagttctttattgtgaaatcagaaaaacaacctgattttcaaaaggaagtc
agaatccttgcgaaagaggcagacgagcaaaaacttgtttacggtatcgtgtatgaacct
gatacagtggacgcccacggagatttcatgacagctgcagaaatcgaaaaggccgctcat
ggattcctgaaagatgctcgtcaaatcgacaagcaacatgactttcagggtggtgttggt
gaggtggttgagtcctatgtcgcaccggcagactttgaaatgaatggggaaaccattaaa
aagggatcatgggtccttgtcacaaaggcttctgaggaagtatgggagcaaatcaaaaaa
ggcgaaattaccggttattcaatggcaggaactgctgagacgattgaaaaacaagaaaag
cccgtttctcaagagaaaacagatgagaaagggctatttaatttgctcaaaaactttttt
gttggaaaacaacagcaatcatatgaagagccagttgcaaaggcgggcagaaaattttcc
gcttcaaacctgcaagaaattaagaatgctcatgctgcccttggtaatttactgagtcag
gtagaaacaaaagagggggaagaagaaatgacttcggaggaagtaactaaatccattcaa
gaagcattagagccaattaagaagcggctcgagacattagaaaaagaggaagagcttaat
aagaaagataaagaaaaagaagaagagactgaaaaagagggcgagaagttgaaaaaggca
atttcagaagctgttcaaccgctcgctgatcgtattgaagcaatcgaaaaaagtcgcgga
acatctaagcaaactgaagaatcgggttccgaacaagttcaaaaatcaatctggtcaggg
ttgttttaa

DBGET integrated database retrieval system